KEGG   Flavobacterium psychrophilum JIP02/86: FP0972Help
Entry
FP0972            CDS       T00548                                 

Gene name
sucD
Definition
(RefSeq) Succinyl-CoA synthetase, alpha subunit
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP0972 (sucD)
   00640 Propanoate metabolism
    FP0972 (sucD)
   00660 C5-Branched dibasic acid metabolism
    FP0972 (sucD)
Enzymes [BR:fps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FP0972 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1232527..1233399
Genome map
AA seq 290 aa AA seqDB search
MSVLVNKDSKIIVQGFTGSEGTFHAEQMIEYGTNVVGGVTPGKGGTMHLDRPVFNTVKDA
VEKAGADTTIIFVPPAFAADAIMEAADAGIKVIIAITEGIPVADMIKANDYIKGKNCRLI
GPNCPGIITPGEAKVGIMPGFVFKKGNVGIVSKSGTLTYEAADQVVKQGLGITTAIGIGG
DPIIGTTTKEAVELLMNDPETHCIVMIGEIGGQLEADAAKWVRADGNRKPVVGFIAGVTA
PAGRTMGHAGAIVGGEDDTAEAKKRILRENGIHVVDSPAEIGKKVKEVLG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttagttaataaagattcaaaaataatagttcaaggatttacgggaagcgaa
ggaactttccatgctgagcaaatgatcgaatacggtacaaacgttgtaggaggcgtaact
ccaggaaaaggaggaacaatgcacttagaccgtcccgtttttaatactgtaaaagatgca
gtagaaaaagcaggagcagatacaaccattatttttgtaccaccagcttttgctgctgat
gctattatggaagctgccgatgcaggtatcaaagtaattattgcaattacagaaggtatt
cctgttgcagatatgataaaagcaaatgattatatcaaaggcaaaaactgccgactaata
ggaccaaactgtccgggtattataaccccaggtgaagctaaagttggtatcatgccaggt
tttgtcttcaaaaaaggaaatgtaggaattgtttctaaatcaggaacattaacctacgaa
gctgctgaccaagtagtaaaacaaggtctaggaataactaccgcaatcggaattggagga
gatccaattattggaactacaacaaaagaagcagttgaattactaatgaatgatccagaa
actcattgcatcgtaatgattggtgaaattggaggacaactagaagctgatgccgctaaa
tgggtacgtgcagacggaaaccgcaaaccagtagttggctttattgcaggagttaccgct
ccagcaggaagaacaatggggcacgcaggtgcaattgtgggtggtgaagacgataccgcg
gaagctaaaaaacgcattttacgtgaaaacggaattcatgtagtagattctccagcagaa
attggtaaaaaagtaaaagaagttttaggataa

DBGET integrated database retrieval system