KEGG   Flavobacterium psychrophilum JIP02/86: FP0975Help
Entry
FP0975            CDS       T00548                                 

Gene name
efp
Definition
(RefSeq) Elongation factor P (EF-P)
  KO
K02356  
elongation factor P
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
Translation factors [BR:fps03012]
 Prokaryotic Type
  Elongation factors
   FP0975 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1230579..1231142
Genome map
AA seq 187 aa AA seqDB search
MASTSDIRNGLCIKFNHDIYKIIEFLHVKPGKGPAFVRTKLRSLSNGKVLDNTFSAGHKI
DEVRVETHTYQYLYAEGDQFHFMNIESFEQITLDKKILDNPGLLKEGTNVMVQVNTETDL
PLSVDMPASIILEVTYAEPGVKGNTATNATKSATVETGASINVPLFINEGDKIKIDTASG
SYMERVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacatcagatataagaaacggattgtgtatcaaatttaaccacgatatttat
aaaataatcgaatttcttcacgtaaaaccaggtaaaggaccagcattcgtacgtacaaaa
ttacgaagcttatctaacggaaaagtattagacaataccttttcggcaggacataaaata
gacgaagttcgtgtagaaacacatacttatcagtatttatacgccgaaggcgatcaattt
cattttatgaatatcgaatctttcgaacaaattactttagacaaaaaaatccttgataat
ccaggattacttaaagaaggaacaaacgtaatggtacaagtaaataccgaaaccgatttg
cctctttctgtagatatgccagcttcaataatattagaagttacgtatgctgagccaggt
gtaaaaggaaatactgctacaaacgcaacaaaatctgcaacggtagaaactggtgcctcc
ataaatgtacctttatttattaatgaaggtgataaaataaaaattgatactgcttcaggt
tcttatatggaacgtgtaaaataa

DBGET integrated database retrieval system