KEGG   Flavobacterium psychrophilum JIP02/86: FP0977Help
Entry
FP0977            CDS       T00548                                 

Gene name
lpxC_fabZ
Definition
(RefSeq) Bifunctional enzyme : UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase and (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K16363  
UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase / 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:3.5.1.108 4.2.1.59]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Fatty acid biosynthesis
Lipopolysaccharide biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FP0977 (lpxC_fabZ)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    FP0977 (lpxC_fabZ)
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FP0977 (lpxC_fabZ)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     FP0977 (lpxC_fabZ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FP0977 (lpxC_fabZ)
Lipopolysaccharide biosynthesis proteins [BR:fps01005]
 Lipid A
  FP0977 (lpxC_fabZ)
Lipid biosynthesis proteins [BR:fps01004]
 Fatty acid synthase
  Component type
   FP0977 (lpxC_fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1228286..1229674
Genome map
AA seq 462 aa AA seqDB search
MVKQKTINNEISLTGVGLHTGNEVRITFKPAPINNGFSFVRVDLEGSPIIEADANYVVNT
QRGTNLEKLGVKIQTPEHVLAALVGCDLDNVIIELNASELPIMDGSSKYFVQAIEKAGIA
EQEAERNVYVVKEVISYLDESTGSEIIVMPCDDYQVTAMVDFGTKVLGTQNASLKNISQF
KDEIADCRTFSFLHELETLLENGLIKGGDLNNAIVYVDKEISAETMNRLKIAFGKDKISV
TPNGVLDNLTLHYPNEAARHKLLDVIGDLSLIGTRIKGKVIANKPGHFVNTQFAKKMSKL
IKNEQRNFVPVYDLNKEPLMDIHKIMSILPHRPPFLFVDRIIEMTDCSVVGLKNVTMNET
FFVGHFPGAPVMPGVIIVEAMAQTGGILILSSVPDPENYLTFFMKIDNVKFKQKVLPGDT
LIFKCDLITPIRRGICHMQAHAYANGKLVAEAELMAQIAKKQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaacaaaaaaccatcaataacgaaatttcccttacaggagttggacttcataca
ggaaatgaagtaaggataacatttaaaccagcccccataaataatggtttttcttttgtt
agagtagatttagaaggttcgcctataattgaagccgatgcaaattatgttgtaaacacg
caacgaggcacaaatctagaaaaattaggcgtaaaaattcagacaccagaacatgtctta
gccgccttagtaggttgcgatttagacaatgttattatcgaattgaatgcttctgaactc
ccaattatggacggttcctcaaaatattttgtgcaagctatagaaaaagcaggcatcgca
gaacaagaagccgaaagaaatgtgtatgtcgtcaaagaagttatttcctatttagatgaa
tctacaggaagcgaaataattgtaatgccctgcgatgattatcaagtaaccgctatggtc
gattttggtactaaagtattaggaactcaaaatgcaagcctcaaaaatattagccaattt
aaagacgaaatagcagattgtcgtacctttagttttttacacgaactagaaactttgtta
gaaaacggattaataaaaggaggcgatttaaacaatgccattgtttatgtagataaagaa
atttctgcagaaaccatgaacaggctaaaaatagctttcgggaaagataaaatttcggtt
acaccaaatggtgttttagacaatcttaccctgcactatcccaacgaagcagcaagacac
aaattactcgatgtaataggagatttatccttaataggaacaagaataaaaggaaaagta
atagcaaataaaccaggtcattttgtaaatactcaatttgcaaaaaaaatgtctaaatta
ataaaaaatgagcaaagaaattttgttccagtttatgatttaaacaaagaaccattgatg
gatattcacaaaattatgagtattttgccacaccgtccgccatttttatttgtagataga
attatcgaaatgacagactgctctgtagttggattaaaaaatgtaacaatgaacgaaaca
ttctttgtaggacattttccaggcgcaccagttatgcctggggtcattattgtagaagcc
atggcgcaaacaggaggaattttaattctaagttcagtccctgatccagaaaattattta
accttctttatgaaaatagataatgttaaatttaaacaaaaagtactaccaggtgataca
ctaatattcaaatgcgatttaataacccctataagaagaggtatttgccacatgcaagct
cacgcttacgcaaatggtaaactggttgctgaagccgaattgatggcgcaaattgccaaa
aaacaataa

DBGET integrated database retrieval system