KEGG   Flavobacterium psychrophilum JIP02/86: FP0978Help
Entry
FP0978            CDS       T00548                                 

Gene name
lpxD
Definition
(RefSeq) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FP0978 (lpxD)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     FP0978 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:fps01005]
 Lipid A
  FP0978 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1227264..1228283
Genome map
AA seq 339 aa AA seqDB search
MKFTAEQIAEILEGEIFGNPKATVFKLSKIEEGTEGCLTFLANSKYTNYIYDTKASIVIV
NRTFVPDNEISTTLIKVEDAYKSFAKLLEFYNQVKNNKTGIEAPCVIAQSAKYGTDFYLG
SFSYIGENVIIGDHVKIYPNSFIGDNVQIGNNTIIFAGAKILSETVIGNNCNIYSGTTIG
ADGFGFAPNPDGTFSKIPQIGNVVIEDNVDIGACTTIDRATLGSTIIRKGVKLDNQIQIA
HNVEIGENTVIAAQTGIAGSTKIGKNCMIGGQVGIAGHLTIGNNVKIQAQSGVGKNIKDK
ETLQGSPSFGYSEYSKSYVHFKNLPKIVTEIEELKKIIK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacagccgaacaaatagccgaaatattagaaggagaaattttcggaaatccg
aaagctaccgtttttaagttgtctaaaattgaagaaggaacagaaggatgcttaacattt
ttagcaaactctaaatatacaaattatatatacgatacaaaagcatcaatagttattgtc
aatagaacatttgtacctgataatgagatttcaaccacattaataaaagtagaagatgct
tataaatcttttgcgaaactattagaattttacaatcaagtaaaaaataataaaacagga
attgaagcaccttgtgtgatagcacaatccgcaaagtatggaacagatttttatttagga
agttttagctacattggcgaaaacgtaattattggcgatcatgtaaaaatatatcccaat
agttttattggcgataatgtacaaataggtaacaacaccattatttttgcaggagctaaa
attctttcagaaacagtaataggcaataattgcaacatatattctggaactacaattgga
gcagatggttttggttttgcaccaaatcccgacggaacttttagtaaaattccccaaata
ggaaatgtagtgatcgaagacaatgtagatattggcgcttgtaccacaatagacagagca
acattaggatctacaattattagaaaaggagtaaaattagacaatcaaattcaaattgct
cacaatgtagaaattggcgaaaatactgtaatagcagcccaaacaggaattgctggttct
acaaaaattggcaaaaattgcatgattggcggacaagtaggtattgcaggacacttaacc
ataggtaataatgtaaaaatacaagcacaatctggagtgggaaaaaatataaaagacaaa
gaaaccttgcaaggaagtccatcatttggctattctgaatatagtaaatcatatgttcat
tttaaaaaccttccaaaaattgttaccgaaatagaagaattaaaaaaaataataaaataa

DBGET integrated database retrieval system