KEGG   Flavobacterium psychrophilum JIP02/86: FP0979Help
Entry
FP0979            CDS       T00548                                 

Definition
(RefSeq) Probable phosphohydrolase
  KO
K06885  
uncharacterized protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1225906..1227141
Genome map
AA seq 411 aa AA seqDB search
MSNTNKLKIFNDPIYGFITIPNPLIYDLIQHPYFQRLRRISQMGLSSLVYPGANHTRFHH
ALGCLHIMQKAIQVLRFKNTIISAEEENALYIAILLHDIGHGPFSHAMEHSIVEAVHHEE
ISLLFMNKLNIEFDGQLNLAIQIFKGEYPRKFMLQLISSQLDMDRMDYLKRDSFYSGVEE
GKINSDRLIQMMNVVDDVLVIEEKGIYSVEKFLMARRLMYWQVYLHKTSLVAELTLTNTL
KRAKELYQKGIAITCSENLLFFIENKISLTDFNNQILNKFAQLDDTDIVGAIKHWQNHQD
FTLSSLSKMIINRDLLKIKMNEENFSKEEIQELIEQFSKANNIAIQEAKYFVFKGKIRNQ
AYSKSAEPIRILKKDGSIEDVALLSDQLSLKALSKQVTKYFLCFPKQLNKN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaatactaataaactaaagatatttaacgatcctatatatggtttcattacgatt
cctaatccgttaatttacgatttaatacagcatccgtattttcagcgattgcgaagaatt
tctcaaatggggctatcatctttagtatatccaggcgctaatcataccagatttcatcac
gctttgggctgcttgcacataatgcaaaaagccattcaagtccttcgatttaaaaatact
atcatttctgccgaagaagaaaatgccttatatattgccattttattacacgatattggt
catggtccgttttctcatgctatggaacacagcattgtagaagcagtgcaccacgaagaa
atttctttgttatttatgaataaattgaatatcgaattcgacggacaattaaacttagcc
attcaaattttcaaaggagaatatcctagaaaatttatgctacaacttatttctagccaa
ttagatatggataggatggattatctcaaacgagatagtttttattctggagtagaagaa
ggaaaaataaactccgacagattaatccaaatgatgaatgtagttgatgatgtattagtc
attgaagaaaaaggaatttattcggtcgaaaaattcttaatggcaagaagactcatgtat
tggcaagtatatttacacaaaaccagtttagttgcagaacttaccttaacaaacacacta
aaaagagccaaagaattgtaccaaaaaggaattgcaattacttgcagcgaaaatttactt
ttctttatagaaaacaaaataagtttaaccgattttaacaatcaaattctaaataaattt
gcacaattagatgatacagacattgttggtgccataaaacattggcaaaaccatcaagat
tttaccttaagttcattaagcaaaatgataataaatcgagatttgctgaaaattaaaatg
aatgaagaaaatttttctaaagaagaaatacaagaattaatagaacaattttcgaaagca
aataatatcgcaatacaagaagcaaaatattttgttttcaaaggaaaaataagaaatcag
gcctatagcaaatctgcagaacctatacgaatcctcaaaaaagacggctctatagaagac
gtagcattattgtcagaccaattgtcattaaaagcattatctaaacaagttacaaaatat
tttctttgttttccaaaacaactcaataaaaactaa

DBGET integrated database retrieval system