KEGG   Flavobacterium psychrophilum JIP02/86: FP0981Help
Entry
FP0981            CDS       T00548                                 

Gene name
kdsB
Definition
(RefSeq) 3-deoxy-manno-octulosonate cytidylyltransferase
  KO
K00979  
3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FP0981 (kdsB)
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.38  3-deoxy-manno-octulosonate cytidylyltransferase
     FP0981 (kdsB)
Lipopolysaccharide biosynthesis proteins [BR:fps01005]
 Unusual sugar
  FP0981 (kdsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1224329..1225054
Genome map
AA seq 241 aa AA seqDB search
MKIIAVIPARYASTRFPAKLMQDLGGKTVILRTYQAAVETNLFDDVFVVTDSELIYNEII
TNAGKAIMSIKEHESGSDRIAEAIQNLEVDIVVNVQGDEPFINKEPLEEVIQVFRNDTHK
KVDLASLMRNITHKNDIQNPNNVKVIVDQKGFALYFSRSVIPYPREENVGVRYMQHIGIY
AFRKQALLDFYHLPMLSLEASEKLEQLRYLEYGKRIKMIETTHVGIGIDTLEDLEKARSM
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattgcagtaattccagcacgctacgcctcaacaagattcccagcaaaactc
atgcaagatttgggcggaaaaacagttattctaagaacctatcaagcagcggtagaaacc
aatttgtttgatgatgtttttgttgtaaccgattcagaattaatttacaatgaaattatt
accaatgctggcaaagccataatgagcatcaaagaacacgaatcgggtagtgaccgaatt
gctgaagccatccaaaatctagaggtagatattgtagtcaacgtacaaggagacgaacct
tttataaacaaagagccactcgaagaagtaattcaagtttttagaaatgatacacataaa
aaagtagatttagcttccttaatgagaaatattacccataaaaatgatattcaaaatcca
aataatgtaaaagtaattgtcgaccaaaaaggatttgcgctctatttctctcgttccgta
attccgtatccaagagaagaaaatgtaggtgtaagatacatgcaacacattggtatatat
gcttttagaaaacaagccttgctagatttttatcatttacctatgctatcactcgaagcc
tccgaaaaattagaacaactccggtatttagaatatggcaagcgcatcaaaatgatcgaa
actactcatgtaggaatcggaattgacactttagaggatttagagaaggcgaggagcatg
ttataa

DBGET integrated database retrieval system