KEGG   Flavobacterium psychrophilum JIP02/86: FP0983Help
Entry
FP0983            CDS       T00548                                 

Definition
(RefSeq) Probable TonB-dependent outer membrane receptor precursor
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1219936..1222359
Genome map
AA seq 807 aa AA seqDB search
MSLQETSKKVLYFLILQLSFFSISNAQTSVTVSGLIKDKNTQSVLSFVNVVLKTEKDSTF
VSGTVTNEEGRFSLSKIKSGNYYLEVSYIGYKTSKKSLFVGTLTEYLDIKNIEIEEKLTS
LQEVLVTGKTAEINEKMDKKTFSLKDNISQSGGSVLQAMQNMPSVTVHDGKVQLRGNDKV
TILIDGKQTALTGFGNQTGLDNIPASAIEKIEIINNPSAKYDANGNAGIINIIYKKNKKD
GFNGKFGFTTGVGSLWVQKENLPTIRPQYTFTPKINPSVSLNYRKNKVNVFFQGDYLYAE
TLNKNEFVTRNYDNGDVINSQLKRNRNTHFTTLKSGFDYAINDQNSLTISGLFGSEKIID
RGDQPFFNNDFLQRNRLWQFLEDELKTTIMATASYQHKFSAAGHLLNIGFNYTFHREDEK
YFYDNYLPTSTGTDAFKLLSDEQVYDFNFDYIKPLKYGRIETGIKFRNRNIPTNMQFIPG
TNSVLDANAGGWATYKELIPAVYGNYIFENKKWEGELGLRIEYVKIQYDVNPNHIVYKSD
VYNYTQPFPNLRLAYKISDNNKVSIFYNRRVDRPNEVDIRIFPKYDDAEIIKVGNPALRS
QFTNSIELGYKKSWGKGSLYNAIYHQFADGTITRISSTVAPNHLIYATFQNVNKSYNTGV
EMVLAQEISKLYAFNINLNAYKNQIDAFTVENKYPSTHTFSANKQEIFSGNLKINNTFHF
PKNIDLQLTAIYLAPDIIPQGKIKSRFSLDFGLKKAIQKGKGELFFNATNLLNTMIIKKE
INGQGFNYTSNDYYETQVLRLGYSYKF
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtctctacaagaaacatcgaaaaaagtactgtattttttaattttacaactttcattc
ttctctatttcaaatgcacaaacaagtgtaacggtttcgggacttataaaagacaaaaac
acccaatcagttttatcttttgtgaatgtagtcttgaaaaccgaaaaggacagcactttt
gtgagtggaactgttaccaacgaagaaggacgattttcattatcaaaaataaaatctgga
aactactatttagaagtttcatatattggctacaaaacatcaaaaaaatcgctgtttgtt
ggtactctaacagagtatcttgacattaaaaatattgaaatagaagaaaaattaacttca
ttgcaagaagttcttgtaacaggtaaaactgccgaaattaatgagaaaatggataaaaaa
acattctctttgaaagacaatattagtcaaagtggggggtcggttttacaagccatgcaa
aatatgccaagtgtaacagtgcacgacggaaaagtacaacttcgtggaaacgataaagta
accatattaattgacggcaaacaaacagcattgacaggttttggcaaccaaacaggatta
gacaatattcctgcatctgcgattgaaaaaattgaaattatcaacaatccttctgccaaa
tatgatgccaatggaaacgcaggaattatcaatattatttacaaaaaaaacaaaaaagat
ggctttaatggaaagtttggctttacaacaggtgtaggttcactttgggtgcaaaaggaa
aatttaccaaccataagaccacaatatacttttacgccaaaaatcaacccaagcgtttca
ctcaattatagaaaaaacaaagtcaatgtcttttttcaaggcgattacttatatgcagaa
acgcttaacaaaaatgaatttgtaacaagaaattacgacaatggcgatgtaattaattcg
caattaaaacgcaacagaaacacacattttacgactctaaaaagtggttttgattatgca
attaacgaccaaaattctttgactatttcaggactttttggaagtgaaaaaataattgac
agaggagaccaacccttttttaataacgattttttacaacgaaacaggctttggcagttt
ttagaagatgaattaaaaacaactattatggcaacagccagctatcaacacaaattttca
gcagcaggacatttgctaaacattggtttcaattacacttttcacagagaagacgaaaaa
tatttttacgataattatttgccaacttctacaggaaccgatgcgtttaaattattgtca
gacgaacaagtgtatgattttaattttgactacataaaaccacttaaatacggacgaatt
gaaacaggtatcaaatttcgtaatagaaacataccaaccaatatgcaatttataccagga
acaaattctgtattagatgccaatgcaggcggttgggcaacttacaaagaattaattcct
gccgtttatggaaactacatttttgaaaacaaaaaatgggaaggcgaactaggtttgcga
attgaatatgtgaaaattcaatatgacgttaatcctaatcatatagtttataaaagcgat
gtttataattacacacaaccatttccaaatttacgtttggcatataaaattagcgacaat
aacaaagtttctattttctacaaccgaagagttgaccgaccaaacgaagttgatattcgt
atttttccaaaatatgatgacgcagaaataattaaagtagggaatcctgcattgcgctca
caatttaccaattcgatagagttgggttataaaaaaagttggggaaaaggaagtttatat
aatgctatttatcaccaatttgctgacggaacgattacaagaatttctagtactgttgca
ccaaatcatttaatttatgcaacatttcaaaacgtaaataaaagttacaatacaggagta
gaaatggttttagcacaagaaatttctaaattgtacgcatttaatattaatttaaacgca
tacaaaaatcaaattgatgcgtttacagttgaaaacaaatatcctagtacacatacattt
tcagcaaacaaacaagaaatattttcaggaaatttaaaaataaataatacttttcatttt
cctaaaaacattgacttacaattaacagctatctatttagcccctgatattattccacaa
ggaaaaataaaatcgagattttcattagactttggacttaaaaaagcaattcaaaaagga
aaaggcgaactgttttttaacgcaactaatttgttaaacacaatgataatcaaaaaagaa
ataaacggacaagggtttaattatacaagcaacgactattacgaaacacaagtattaaga
cttgggtatagttataaattttaa

DBGET integrated database retrieval system