KEGG   Flavobacterium psychrophilum JIP02/86: FP0987Help
Entry
FP0987            CDS       T00548                                 

Definition
(RefSeq) hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1216054..1217052)
Genome map
AA seq 332 aa AA seqDB search
MTSETEIYNKLELHYFFSEEDKTHTMDAVIRNKCEHELLQIVSTVSKELGFQLKIETEAY
EEGGLVEFYNFIGSAEGQAIMALSNFAITVIGIIVARIPLRKSKLDIKEQKLSIKEKKLN
IEAQKLNLKLLKIELEKKNVELPNINIEKINFIINNNIKVIKHTSNFYKTLYNYPKVRKL
STSIVDSTKKQIEEPQFVNREDFEKFFLESDNLEPIFDEKASIEIISPVLKKGNYKWRGI
YNLNPIPIEFSMNKEFKDKVIQDGITFKNGTFIDCILKIDRKVDDLGNIYNSNYYVETVL
RQHNEGIIIETSQGKQYRERKEAIKNQIRLFE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgaaacagaaatctataacaaacttgaactacattacttttttagtgaagaa
gacaagacacacacaatggatgctgttatcagaaataaatgtgaacacgaattattacaa
atcgtttcaacagtttcaaaggaattaggttttcaactaaaaattgaaactgaagcatac
gaagaaggtggtttagttgaattttataatttcataggaagcgcagaaggtcaagcgatt
atggctctttctaattttgcaataaccgtaattggaatcattgttgctcgcattccttta
agaaaatctaaacttgacattaaagagcagaaattaagtataaaagaaaaaaaactaaat
attgaagctcaaaaattaaacttaaaattattaaaaattgaacttgagaaaaaaaatgta
gaattaccaaatataaacattgagaaaattaattttatcatcaacaacaatataaaagta
attaagcatacttcaaatttttataagactctgtacaattacccaaaagtccgtaaattg
tcaacttcaattgttgattctactaaaaaacaaattgaagaaccacaatttgttaatcgt
gaagattttgaaaaattctttttagaaagtgataatttagaaccaatatttgacgaaaaa
gcatctatagaaataatttcaccagtattaaaaaaaggaaactataaatggagaggaatt
tataatcttaatccaattccaattgaattttcaatgaataaagaatttaaagataaagta
attcaagatggaataactttcaaaaatggtacattcattgattgtatattaaagattgac
agaaaagttgatgatcttggaaatatctataattctaattattatgttgaaactgtatta
agacaacataacgaaggaataattatcgaaacatcacaaggaaaacaatacagagagaga
aaagaagcaattaaaaaccaaataagactatttgaataa

DBGET integrated database retrieval system