KEGG   Flavobacterium psychrophilum JIP02/86: FP0988Help
Entry
FP0988            CDS       T00548                                 

Definition
(RefSeq) Probable TonB-dependent outer membrane receptor precursor
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1213688..1215784
Genome map
AA seq 698 aa AA seqDB search
MKKALIILFGLMISNLALAQNEVKQDTISKKLEEVIIKTEKKVFTNKNGNLKVDVANSIL
KSVPNTIDLVSKLPNVIIDANKETINIIGKGNPLLYIDNQKVSINDLNALSVDEIKSIEI
INNPSAKYEAEGRVVILITRKLSKKEGFKIDLTETASVKKRFNNYVGVNASIKKKKLEIK
ANFNYNQLTIWEGHDIKYEIPEENIISNYDVEAYTKRPQFIFGSGLFYKINDDDYFSISG
NARAQKDIFGINTKTFNKQNTIENNILTRSNNDNNRVYINSFANYAKKIKSINTQLFSGF
QFSNFNQEMVTLVENSYNNSPFQLVQNRNQQFNVSVISGRTDLEKTFKNEIKLEIGGLFL
SANAQTNSDISNLINLTLATSKYNFKEQNISGYSQVSGKIKKVQYSAGFRIENTNIIGKY
TNEILPLIKKDYTNFFPKVQLDIPLDSSKTITLNYAKSIIRPNYSATNQGSTYINPYFIY
GSNINLDPTINDEIAANFQYNDKSIRLRYYKNSNPVYGDFKYDNFQNILTFSEKNFDKEM
GLEIDFTIPFTYKFWTVNNSLSFILNKIEDKLALQKESKPYMYYYSNHVFKLPKEYTIST
TVWGLTTQHEGVFERKQPNFLIDLAISKKFLKQWDCTLSFNDIFKNFVYKENFTVNKVSS
KSHYLSDTHEISLAIRYSFGKIKDSEFKEKSINENRIR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcactcataatactgtttggtctgatgatttcaaatttggcattggcacaa
aatgaagtcaaacaagatacaatttctaaaaaattagaagaagtaatcataaaaacggaa
aagaaagtttttaccaataaaaacggaaatttgaaagttgatgtagccaattctatatta
aaatcagttccaaatacgatcgatttagtatcaaaactgcccaatgtaattattgatgcg
aataaagaaacgattaatattataggaaaagggaatccattactttatatagacaatcaa
aaagtaagtataaacgatttaaatgcattgtctgtagatgaaattaaaagcattgaaatt
ataaataatccatcagcaaaatacgaagcggaaggtcgagttgtcattttaattacaagg
aaattgagcaaaaaagaaggatttaaaatcgatttgacagaaacagcttccgtcaaaaaa
agattcaataattatgtaggagttaatgccagcatcaaaaaaaagaaattagaaattaaa
gcaaatttcaattacaatcagttaactatttgggaaggacacgatataaaatatgagatt
cctgaggaaaatattatttcaaattatgatgtagaagcttatactaaaagacctcaattc
atttttggaagtggattattttacaaaataaatgacgatgattatttttctatcagtgga
aatgccagagctcaaaaagatatttttggtatcaatacaaaaacttttaacaaacaaaat
actatagaaaacaatattttaacacggagtaataacgataacaatcgagtttatataaat
tcctttgcaaattatgctaagaaaataaaatcgataaatacacaattattttcaggtttt
cagttttctaatttcaatcaagaaatggttactttagttgaaaatagttataataattct
ccatttcaactagtacaaaataggaatcagcaatttaatgtttcggttatttctggtaga
acagatttagaaaaaacgtttaaaaatgaaataaaattagagattggaggtttatttctt
agtgccaatgcccagacaaattcggatatttcaaacttaattaatttaactttagcgacc
tcgaaatataattttaaagagcaaaatatttcaggttattcgcaagtttcaggtaaaata
aaaaaggtgcaatattcagcaggttttagaattgaaaatactaatattattgggaaatac
actaatgaaattttgcctttaattaaaaaagattacactaattttttcccgaaagtacaa
ttagatattccgttagatagttcgaaaacgattactttaaattacgctaaaagtataatc
agacctaattattcggctacaaatcagggttctacttatatcaatccttattttatttac
ggaagcaacattaatttagatcctacaattaatgatgaaattgcagctaattttcagtac
aatgacaaatcgattagattgcgttattataaaaattcgaatcctgtttatggggatttt
aagtatgacaactttcaaaatattttaacttttagtgagaaaaattttgataaagaaatg
gggttagaaatagattttacgattccgtttacttataaattttggacagtaaacaatagt
ttaagttttattttaaataaaattgaagacaaattagccctacaaaaagaatctaaacct
tatatgtattattactctaatcatgtatttaaattacctaaagaatacacgatttctacc
acagtttggggattaacaacgcaacatgaaggtgtttttgaaagaaagcaacctaatttt
ttaatagatttggctatttcgaaaaaatttttaaagcagtgggattgtactttaagtttt
aatgatatttttaaaaatttcgtttataaagaaaatttcacggtaaataaagtgagctcg
aagtcacactatctatcagatacgcatgaaatttctttagcaattagatattcttttgga
aaaataaaagattcggaatttaaagagaaaagtatcaatgagaatagaatacgctaa

DBGET integrated database retrieval system