KEGG   Flavobacterium psychrophilum JIP02/86: FP0989Help
Entry
FP0989            CDS       T00548                                 

Definition
(RefSeq) Protein of unknown function precursor
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1212645..1213622
Genome map
AA seq 325 aa AA seqDB search
MKKILLIMLLISKNYAIAQKTPEDFGYKQMSFKFQDDKVDLIVISKKGEEKIAKPLFFFC
QGSLPRPVVIYDEKGLYGTLPFNETPFLDDFHIIIIAKPAIPIIANANILGKNFMYLKDK
ENEIPPKGYTDRNYLDYYVFRNNFILKQLSKERWVSKKKLVVAGHSEGSSIASKMAILYP
KITHLIYSGGNPFGRIVNILSEERDKENTINYWKTVVENSAVINYNGGDTYKATYSFSLP
QRQNLVQLKIPILVTYGSKDVAANYNDLFQIEIIRDRKQNFKFINYPDLEHNFFAVNEKL
EPIYEKENWDKVAKDWLDWLHNSTN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatactgctaattatgctcttaatttcaaaaaattacgccattgctcaaaaa
actccagaagattttgggtacaaacaaatgtcattcaaatttcaagatgataaagtagat
ttgattgttatttctaaaaaaggagaagaaaaaatagccaaaccattgttctttttttgc
caaggaagtttgccaagacctgttgttatttatgacgaaaaaggattgtatggtactttg
ccttttaacgaaactccttttttagatgattttcatatcataattattgcaaaaccagct
attccaattattgcaaatgctaacatcttgggcaaaaattttatgtatttgaaagacaaa
gaaaatgaaattccacccaaaggttataccgataggaattatctagattattatgttttt
aggaacaatttcattcttaaacaattaagtaaagagcgatgggttagtaagaaaaagctt
gttgttgctgggcattctgaaggaagttctattgcttcaaaaatggcgattttatatcct
aaaataacgcatctcatttattctggagggaatccttttggtcgaattgtaaatatttta
tcagaagaaagggataaagaaaacaccataaattattggaaaacggtagtcgaaaacagt
gctgttatcaattataatggcggtgatacttataaagctacttatagtttttcgttgcca
caaaggcaaaatttagtacaacttaaaattccaattttagtgacttatggctcaaaagat
gtggcagcaaactacaacgatttatttcaaatagaaattattcgtgaccgaaaacagaat
ttcaaatttataaattatcctgatttagaacataattttttcgctgtaaatgaaaaatta
gaacctatttatgagaaagagaattgggataaagtggcaaaagactggttagactggtta
cataattcaacaaattaa

DBGET integrated database retrieval system