KEGG   Flavobacterium psychrophilum JIP02/86: FP0990Help
Entry
FP0990            CDS       T00548                                 

Definition
(RefSeq) Two-component system sensor histidine kinase
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1211170..1212528)
Genome map
AA seq 452 aa AA seqDB search
MKKKINLLILFSVVVLIALSVMQFYLVKTTYDYKVAQFRAEIKTKIADITNDYSDIDSTI
FNKKDLLYRELAMRYILDPKTRNRIKNAILQNQFKEELTHKLQLKFEQEIPDLKLDFAIV
LNKFVLYNNAKAADTIFAEKPIIGNKLYGDLASLDDAFLVRNYVGTTSGNTLNSDFKLLT
EDALYVSVANWETIILRRMAMILGFAILSILTLITLFVIAIKALIKQKKVSDIKTDFINN
ITHELKTPLATLAISTKILERKEIRDNQQHFDNLVATISRQNNRLQQLIDQVLNNSLEDS
EIKLKKEKINSEVFLNVITNDFKISNPSIAISTEFKTVQTSLFLDKFHLTTAIQNVLENA
AKYGCHHINIRTSLVNNQFNISIEDDGIGISKNKHSLLFDKFYRVEQGNLHNVKGLGLGL
YYVNQIIKAHKGTIMVISDLGKGAIFNISIPF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaaatcaacttattaattctgttttcggttgtggtgcttatagcactttcg
gttatgcaattttatttggtaaaaactacttatgattataaagtagcacaatttagagcc
gaaataaaaaccaaaattgccgatattacaaacgattatagtgatatcgattcgaccatt
tttaacaaaaaagatttgttgtatcgcgaattggcgatgcgttatattttagatcctaaa
accagaaacagaattaagaatgccattcttcaaaaccaatttaaagaagaattaacgcat
aaattacaacttaaattcgaacaagaaatcccggatttgaaactagattttgccattgta
ctcaacaaatttgtattgtataacaatgccaaggcagctgataccatttttgctgaaaaa
ccaatcattggaaataaactatatggtgatttagcatcactagacgatgcttttttggtc
cgaaattacgtaggaaccacaagcggaaataccttgaattctgatttcaaattacttacc
gaagatgctttgtatgtttcggtagccaattgggaaactataatcctgagacgaatggct
atgattttaggctttgcaattctttcaattctcacgttaattacgctatttgttattgct
attaaagcattaataaaacaaaaaaaagtaagcgacattaaaacagattttattaataat
attacccacgaattaaaaacgccattggctacattagctatttctactaaaatattagaa
agaaaagagattcgagataaccagcaacattttgataatttagtagccactatatctcgt
caaaataatcgtttgcaacaattaatcgatcaggttttaaataattcattggaagacagc
gaaataaaattgaaaaaggaaaaaattaattccgaagtttttttaaatgtaattaccaat
gattttaagatttctaatccatcaattgcaatttcaaccgaatttaaaaccgtgcaaact
tccttatttctagacaagtttcatctcacaacggctattcagaatgtgttagaaaatgca
gcaaaatatggttgtcatcatattaatatccgaacttcattagtaaacaaccaatttaat
attagtattgaagacgatggaattggaatttcaaaaaataagcattccttactttttgat
aaattttaccgagtagaacaaggcaatttacacaatgttaaagggttagggttgggtttg
tattatgtaaatcagattataaaagcccataaaggaactattatggtgattagcgatttg
ggaaaaggagctatttttaatattagtattcctttttga

DBGET integrated database retrieval system