KEGG   Flavobacterium psychrophilum JIP02/86: FP0992Help
Entry
FP0992            CDS       T00548                                 

Definition
(RefSeq) Probable transcriptional regulator, TetR family
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1209783..1210361
Genome map
AA seq 192 aa AA seqDB search
MIKKEKITDKKNALLNATLTLVNNHGFHDAPMSKIAKLAGVATATIYLYFDSKQDLINTL
YLEVKTSFSNCALEGYNKNLPVKKGFEMIWYNIADYKLNKITEAKFLSQCDSTPMIDDEV
QKEGLKHLQPLLDLWEKGKEEGIIKPISNFVLYAYAIYPLSFLMSMQERSLYSLNKKTLN
ETFQLAWDAIKV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagaaaaaataacagataaaaaaaatgctttactaaatgctaccttaaca
ttggttaataatcatgggtttcatgatgctccaatgtctaaaattgcaaagttagctggt
gtagcaacagctacaatctatctttattttgatagcaaacaagatttaattaatacactt
tatcttgaggtaaaaacttcatttagcaattgcgctcttgaaggttataataaaaattta
cctgtaaaaaagggttttgaaatgatttggtacaatattgcagattataaattaaataaa
ataacagaagctaaatttttatcacaatgcgatagtacacctatgattgatgatgaggtg
caaaaagaaggattaaaacatttacagcctctacttgatttatgggaaaaaggaaaagag
gagggtattattaaacctatttcaaattttgtactttatgcctacgctatatatccgtta
tcatttctaatgtctatgcaagagaggagtctatattcactgaataaaaagacattaaat
gaaacttttcagttagcttgggatgctataaaagtctaa

DBGET integrated database retrieval system