KEGG   Flavobacterium psychrophilum JIP02/86: FP1006Help
Entry
FP1006            CDS       T00548                                 

Gene name
ybcL
Definition
(RefSeq) Probable phospholipid-binding protein precursor YbcL
  KO
K06910  
uncharacterized protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1194041..1194580)
Genome map
AA seq 179 aa AA seqDB search
MKNIFLSLSMLFCIYTNAQTFTLKSNDIGGQATNKQVFSGFGCTGGNTSPELSWSNAPVG
TKSFAVTMYDPDAPTGSGWWHWVVFDIPENEMQLKQNAGNLTLDLAPKGSVQSLTDFGKA
GYGGPCPPEGHGFHQYIITVYALKTKMLGLDKNANPALVGYYLNGNTIEKASIVAYYKR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttttttatcattatcaatgctcttttgcatttatactaacgcacaaact
tttacattaaaaagtaacgacattggtggtcaagcgactaacaaacaagtttttagtggt
tttggctgtacaggaggaaatacttctccagaattatcatggtcaaacgcacccgtagga
acaaaaagttttgcggtaactatgtatgatccagatgctcctacaggaagcggatggtgg
cattgggttgtttttgatattccagaaaacgaaatgcaattaaaacaaaatgcaggaaat
ttaactttagatcttgccccaaaagggagtgtacaaagccttaccgattttggaaaagct
ggctatggtggcccttgtcctccagaaggtcacggttttcatcaatacataattactgtt
tacgccttaaaaactaaaatgcttggtctagacaaaaatgcaaatcctgcactagttggc
tattatttaaatggtaatacgatagaaaaagcttcgatagttgcttattacaaacgataa

DBGET integrated database retrieval system