KEGG   Flavobacterium psychrophilum JIP02/86: FP1009Help
Entry
FP1009            CDS       T00548                                 

Definition
(RefSeq) hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1190756..1191490)
Genome map
AA seq 244 aa AA seqDB search
MKKKAIFNWSSGKDSALALYKTLQDTEIEIVSLLTSVNKKHNRISMHGVRTQLLVQQAKS
IGLPLHIMEIPEMPSMNDYEEVMQKTLKNFKEKGISHSIFGDIFLEDLRKYRENKLAEMQ
LEAIFPLWKIPTKALILEFLALGFKTIVVCVNERNLDKSFVGRVIDAQFIADLPDDVDLC
GENGEFHTFTFDGPIFKKPIEFEIGEIVYRKYEKPKQESSNTACDTSSSDAFDFGFWYCD
LIPK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaaagccatttttaattggagtagcggaaaagattctgctctagcattatat
aaaaccttgcaagatacagaaatagaaattgtttcgttgcttacaagcgttaataaaaaa
cacaatcgcatttcgatgcatggtgtgcgtacccaattgttagtacaacaagccaaaagt
attggtttaccgcttcatatcatggaaattccagaaatgccaagcatgaacgattatgaa
gaggtaatgcaaaaaactctaaaaaactttaaagaaaaaggaatatcacattctattttt
ggggatatttttctagaagatttgcgaaaatatagagaaaataaattagccgaaatgcaa
ttagaagctatttttccgttatggaaaattcctaccaaagcgttaattctggagttttta
gctctaggtttcaaaactattgtggtttgtgttaatgaacgaaatcttgataaaagtttt
gtgggtcgagtcatagatgctcagtttattgccgatttgccagatgatgtagatctttgt
ggcgagaacggagagtttcatacttttactttcgatggtcccatttttaaaaaaccaatc
gaatttgaaataggcgaaattgtgtatagaaagtacgaaaaaccaaaacaagaatcatct
aataccgcttgcgatacaagtagttccgatgctttcgattttgggttttggtattgtgat
ttgattccgaaatag

DBGET integrated database retrieval system