KEGG   Flavobacterium psychrophilum JIP02/86: FP1017Help
Entry
FP1017            CDS       T00548                                 

Definition
(RefSeq) Two-component system sensor histidine kinase
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1181115..1183727)
Genome map
AA seq 870 aa AA seqDB search
MNTLEFNFNEDSFNKLFPFYILIDTNLKIKSFGKSLAKICPNIKKSLSFKNNFEVVRPHL
DNLNFNELASNCNQLIIIKYINSNTPIRGQFELINNSLLFVGSPWFGSMSDVIEKKLTLH
DFAIHDPLLDLLHILNNQENTANELKELLTTINDQKNKLKQANKEIHDIALFPTQNPDPI
IRIDTKGNLLKRNPAAEKLSSFIYDEINYKIEDFFKFIITKIDPEKERWIFEIQNDQKYY
SFVCISLKEDNYINIYGRDITQQKKTEEESNRLSLVASANQNGVVFTNPNGIIFWCNNAY
LKLTGFSREEVIGKTPIEIGKTNHTNKSDLKKMIEPFYKGIPFDIDLIHARKDGSSFWSK
NKGQPILNSKGEVIQYFAMIEDISLKKRYDESLQNEKEKYRSIIANMNLGLLEVDLNDVI
TLANNSFLTISGYSSEELIGKKAAELLLTQESKKLVKSKNEIRKKGKTDSYEVKVIDKFG
KNRHWLISGAPNYNAMGELIGTIGIHLDITLQKEQEEKLYLLSLIAEKNINSVIIANPEG
KIEWANKSFIEISGYTIEELIGKRPGNLLQGKETNPETIIYLRDQIKKGLPFNCEIINYS
KQGKKYWINIQGQALYNKKGQIVKFFAIEENITKKKELEEKQDFLVKSLAKSNKELEDYA
SIVSHDLKSPLRSIHSLISWIKEDNDNQLNDQTLQYLSLIEGKVEKMDYLIEGILTYAKI
DKINLASEKVNTHEIIENIINIIHIPNHINVSIIGKLPIINADKFRIQQLFQNIISNAVN
YIDKPIGTVNVSCIEKDGKYIFSIQDNGPGIAKENQEKIFKIFQSLQKSDKSTGLGLSIV
KKIIETYNGKIWLESQINHGTTFFISLNDQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattagaatttaattttaacgaagatagttttaacaaattattcccattttat
attctaattgataccaacttaaaaataaaaagttttggtaaaagtttagctaaaatttgt
cctaatattaaaaaatcactttcctttaaaaacaattttgaggttgttaggccccaccta
gacaacctcaatttcaacgaattggcttcaaactgtaatcaattaattataataaaatat
ataaatagtaataccccaattcgtggacaattcgaattaattaacaattcgcttttattt
gtaggttctccctggtttggttctatgagtgatgttatcgaaaaaaaactaacattacat
gattttgcgattcatgacccgttgttagatttactacatattcttaataatcaggagaat
accgctaatgaattaaaagaattgttaacaacaataaacgatcaaaaaaacaaattaaaa
caagccaataaagaaattcatgatattgcgcttttcccaacacaaaatcctgatccaata
attcgaattgataccaaaggaaatttactaaaaagaaatccagcagccgaaaaattatct
tcatttatttatgatgaaattaattataaaatagaagattttttcaaatttattattaca
aaaatagaccccgagaaagagcgttggatttttgaaatacaaaacgaccaaaaatattat
tcctttgtttgtataagcctaaaagaagataattatattaatatttacggccgggatatc
acacaacaaaaaaaaacagaagaagaatcaaatcgtctatcattagtagcaagcgctaac
caaaatggtgtcgtttttacaaaccccaacggaataatattttggtgtaacaatgcctat
ttaaaacttacaggattttctcgagaagaagttattggaaaaaccccaatagaaatagga
aaaacaaatcataccaataaaagtgatttaaaaaaaatgatcgaaccgttttataaagga
atcccttttgatatcgatttaatacatgcccgcaaagacggtagtagcttttggtctaaa
aacaaaggacaaccaattttaaattcaaaaggagaagtaattcagtattttgctatgatt
gaagacatttcgctaaaaaaacgatacgacgaaagtttgcaaaacgagaaagaaaaatat
cgaagcattattgccaacatgaatcttggtcttttagaagttgatctaaatgacgttatc
acccttgctaataatagtttcttaaccattagtggttattcttctgaagaattaatagga
aaaaaagctgccgaattattactaacacaagaaagcaaaaagttagtaaaaagtaaaaat
gaaattcgaaaaaaaggaaaaacagattcgtatgaagttaaagtaatcgataagtttgga
aaaaacagacattggctaattagtggtgcacccaattataatgcaatgggagaattaata
ggcaccataggaatacatcttgacattaccctacaaaaagagcaggaagaaaaactatac
ttattatcattaattgccgaaaaaaatataaattctgttatcattgctaatccagaaggc
aaaattgaatgggcaaacaaaagctttatcgaaatttctggatacacaatagaagaactc
attggcaaaagaccaggaaatttactacaaggcaaagaaacaaaccccgaaacaattatt
tatttacgagaccaaataaaaaaaggattaccctttaactgcgaaatcattaattattct
aaacaaggaaaaaaatattggataaacatacaaggtcaggcattatacaataaaaaaggt
caaattgttaaattttttgcaattgaagaaaatataactaaaaagaaagaactcgaggaa
aaacaagattttttagtaaaaagtttagcaaaaagtaataaagaattagaagattatgcc
tcgattgtatcgcacgatttaaaatcaccattaagaagtatccattctttaatatcttgg
attaaagaagataacgacaaccaattaaacgatcaaacattacaatatctatcattaatt
gaaggaaaagtagaaaaaatggactatttaattgaaggaattttaacctatgctaaaata
gataaaataaatttggcttcagaaaaagtaaatacacatgaaataatagaaaatattatc
aatataattcatattcccaatcatattaatgtatcaattataggaaaattaccaattata
aatgccgataaatttagaatacaacaactttttcaaaatattataagcaatgccgtaaat
tatatagacaaaccaattggtactgtcaatgtaagttgcatcgaaaaagacggcaaatat
atattttctattcaagataacggaccaggtattgctaaagaaaaccaagaaaaaatattt
aaaatttttcaatcactccaaaaatcagacaaatcaacaggcttaggcctttcgatagta
aaaaaaattatagaaacctataacggtaaaatatggctagaaagccaaattaatcatgga
acaacattttttatatcgctaaacgatcaataa

DBGET integrated database retrieval system