KEGG   Flavobacterium psychrophilum JIP02/86: FP1020Help
Entry
FP1020            CDS       T00548                                 

Definition
(RefSeq) Probable two-component system histidine-containing phosphotransfer protein (HPt)
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1178634..1178951)
Genome map
AA seq 105 aa AA seqDB search
MEKPNSNYINQLSGDNEDFKTKVIGILKKELPEEITIYEHLIQTKKYKLASESVHKLKHK
ISILGLEKSYYIAEEFENNLKENSTKLQPDFETILKSMQDFVNTL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacctaattctaactacatcaatcaattatcaggagataatgaagattttaaa
accaaagttatcgggatattaaaaaaagaattacccgaggaaataacgatttatgaacat
ctaattcaaaccaagaaatacaaattagcatcagaaagcgttcataaactgaaacataaa
atttctatccttggtcttgaaaaaagttactatattgccgaagaatttgaaaataatttg
aaagaaaattctacaaaattgcaacctgattttgaaaccattttaaaatctatgcaggat
tttgtaaatacattataa

DBGET integrated database retrieval system