KEGG   Flavobacterium psychrophilum JIP02/86: FP1032Help
Entry
FP1032            CDS       T00548                                 

Gene name
udp
Definition
(RefSeq) Uridine phosphorylase
  KO
K00757  uridine phosphorylase [EC:2.4.2.3]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00240  Pyrimidine metabolism
fps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FP1032 (udp)
Enzymes [BR:fps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     FP1032 (udp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 5300338
NCBI-ProteinID: YP_001295937
UniProt: A6GYF3
Position
complement(1160851..1161717)
Genome map
AA seq 288 aa AA seqDB search
MIQSSELILNPDGSVYHLNLLPENIAHDIIFVGDQERVSKITQHFDSIEFSTQKREFKTQ
TGTIKGKRITVMSTGIGPDNIDIVMNELDALVNIDLATRKPKENLTSLNIIRIGTSGSLQ
ADIPCDSFVMAKFGLGLDNMLRSYLIDEVSIPEMEDAFIKHTNWDLRKGKPYIIPCSEEL
EKLIESEKIHKGITATAGGFYGPQGRVLRLNIQDESLNSKMDNFNFEDNRITNLEMETSA
IYGLGKLLGHHCLSLNAIIANRASGTFSQDPYKAVDELIAYALEKLSK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatacaatcatcagaattaatactaaacccagacggaagtgtatatcacttaaaccta
cttcctgaaaatatagcacacgacattatttttgtaggtgaccaagaacgcgtatcaaaa
attacacaacatttcgatagcatcgaattttcaacacaaaaaagagagttcaaaactcaa
acaggaacaataaaaggcaaacgaattacagtgatgtctacaggaattggtccagacaat
atagatattgtaatgaacgaattagatgctttagtcaacatcgatttagcaacacgcaaa
ccaaaagaaaatcttacctctttaaatattattagaataggcacttcaggctctttgcaa
gccgatataccttgtgatagttttgtaatggcaaaattcggattaggattagacaacatg
cttcgctcctatttaatcgacgaagtttcaatacctgaaatggaagatgcttttataaaa
cacaccaattgggatttaagaaaaggaaagccttatataattccttgttcagaagaatta
gaaaaactaatagaaagcgagaaaatacacaaaggaattacagcaaccgcaggaggcttt
tatggtccgcaaggtcgtgttttacgtctaaatattcaagacgaaagtttaaattctaaa
atggataacttcaattttgaagacaacagaattaccaatctagaaatggaaactagtgca
atatatgggcttggtaaacttttaggtcatcattgcttgtcactaaatgctatcattgcc
aatcgtgcttctggaacctttagccaagatccttacaaagccgttgatgagttaattgcg
tatgctttagagaaattaagtaaataa

DBGET integrated database retrieval system