KEGG   Flavobacterium psychrophilum JIP02/86: FP1039Help
Entry
FP1039            CDS       T00548                                 

Definition
(RefSeq) MutS family protein
  KO
K07456  
DNA mismatch repair protein MutS2
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:fps00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    FP1039
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     FP1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1153678..1155843)
Genome map
AA seq 721 aa AA seqDB search
MISITEKTLQDLQFSTVLETVSSICNTDIGAAKALEITPFKDEETMMTALHQTSEYIASF
QNNNAIPNHGFDAITYEIKFLGIEDSFLEVGSFRKIATLSENTNVLLQYFKKFEDYYPNL
YKKSSQIELTKYIISSIADVVDKYGEIKDNASPNLLEIRRDMNLVRGKVNQSFGMALTQY
NSLGYLDDIKESFVNNRRVLAVLAMYRRKVKGTILGSSKTGSLAFIEPEATLRYSRELSN
LEYEEKEEITRILKLLTNIIRPYLPLLIQYQDFLSDIDVIAAKAKYANRINGILPKITKE
RRIYFRDAYHPILYLTNKGKNEITHPQTIEFDSKNRIIVISGPNAGGKTISLKTVGLLQL
MLQSGMLIPVHERSETCLFDRILTDIGDNQSIENHLSTYSYRLKNMNYFLKKCNAKTLFL
IDEFGTGSDPDLGGALAEIFLEEFYHREAFGIITTHYTNLKILANELPFATNANMLFDEK
SLEPMYKLALGQAGSSFTFEVAQKNGIPFGLINRAKKKIETGKVRFDKTIANLQKERSKM
EKTSINLKEEETKAREESKKMETINAKVKQKLENYQELYDSNQKTIYLGQKIEALSEKYF
NNKNKKELLGEFLKVVEIENSKRIKATKTEIKAIAEKKKVIIEEVTVQVEEIRKEKKEKK
LKANLVPEKVKVILKIGDRVRMLDGKSVGTIDKIEKNKAIVNYGVFTSKVNLEALEFVQP
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattaccgaaaaaacccttcaagatttacaattttctactgttttagaaaca
gtttctagcatttgcaatactgatattggtgcagcaaaagccctagaaataacacctttc
aaagacgaagaaacaatgatgacagctttgcatcaaacctcagaatatatagcttctttt
caaaataacaatgccattcctaatcatggttttgacgccattacttatgaaataaaattt
ctaggcatcgaggatagtttcctagaagtaggaagttttcggaaaattgcaactttatct
gaaaacacaaatgttttacttcaatatttcaaaaaatttgaagattattatcctaattta
tataaaaaatcaagccaaattgaactcacaaaatacatcattagtagtatagccgatgta
gtcgataaatatggcgaaataaaagacaatgcttctcccaatttattagaaattcgtagg
gatatgaacctagttcgtggcaaagtaaatcaaagttttggcatggcactaacccaatat
aatagtttgggttatttagatgatattaaggaaagctttgttaataaccgtagggtttta
gcggtcttagctatgtatcgtcgcaaggtaaaaggaaccattttaggaagctctaaaaca
ggaagtttagcctttatagaacccgaagctacactaagatattcccgagaattaagtaat
ttagaatatgaagaaaaagaagaaataactagaattttaaaactattaactaatataatt
cgtccgtatttaccactactaattcagtatcaagattttttaagtgacatcgatgtaatt
gctgccaaagcaaaatatgccaacagaataaacggaattttgccaaaaataacaaaagaa
agaagaatatattttcgtgatgcctaccaccctattttgtatttaacaaataaagggaaa
aacgaaattacacatccgcaaaccatcgaatttgattctaaaaacagaattattgtaatt
tctggacctaatgctggaggaaaaactatttccttaaaaactgtaggactgctacaatta
atgttgcaatctggaatgctaattccagtgcacgaacgaagcgaaacctgcttatttgat
cgaattttaacagatattggcgacaaccaatcgattgaaaatcatttaagtacttacagc
tatcgattaaaaaatatgaactattttctaaaaaaatgcaatgcaaaaacattgttttta
atcgacgaatttggtactggttccgatcctgatttgggtggcgctttagcagaaattttc
ttagaagaattttaccatcgtgaagcttttggaattattacaacacattataccaatctt
aaaatactagctaatgaactgccatttgctacaaatgccaacatgctttttgacgaaaaa
tcactagaacccatgtataaattagctttaggacaagcaggaagttcctttacatttgaa
gtagctcaaaaaaatggcattccgtttgggttaataaatcgtgccaaaaagaagatagaa
actggtaaagttcgtttcgacaaaaccattgctaatttgcaaaaagaacgatctaaaatg
gaaaaaacttcaattaatctgaaagaagaagaaaccaaagcacgtgaagaaagcaaaaaa
atggagactataaatgcaaaagtcaagcaaaaattagaaaactaccaagaattatatgat
agtaaccagaaaaccatctatttagggcaaaaaatagaagccctttcagaaaaatatttt
aataataaaaataaaaaagaattacttggtgagtttttaaaagtggtagaaattgaaaat
tcaaaacgaataaaagccactaaaactgaaataaaagccattgccgaaaagaaaaaagta
attatagaggaagtaaccgttcaggttgaagaaattcgtaaagagaaaaaagaaaagaaa
ctcaaagcaaatttagtacctgaaaaagtaaaagtaatactaaaaataggcgatagagtt
agaatgctcgacggaaaatctgtaggtacaatagataaaatcgaaaaaaacaaagccatt
gtaaactatggtgtttttacatcaaaagtaaatttagaagctttagaatttgtacagcca
aaataa

DBGET integrated database retrieval system