KEGG   Flavobacterium psychrophilum JIP02/86: FP1042Help
Entry
FP1042            CDS       T00548                                 

Definition
(RefSeq) ABC-F family ATPase
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_23 FimH_man-bind AAA_29 NB-ARC ATP-synt_ab RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 5299002
NCBI-ProteinID: YP_001295947
UniProt: A6GYG3
Position
1148616..1150232
Genome map
AA seq 538 aa AA seqDB search
MLTISNLSVQFGKRILFDEVNTTFTQGNCYGIIGANGAGKSTFLKIIAGEIDPTSGRVIL
EPGKRMSVLNQNHNMFDDLTVLETVMMGNKVLFAVKKEMDDLYADYTDANADRIGELQVR
FEEMNGWNAESDAGAMLSNLGISADYHYTLMGDMEGKLKLRVLLAQALFGNPDVLIMDEP
TNDLDFETIGWLENFLANYENTVLVVSHDRHFLDSVCTHVSDIDYGKINHYSGNYTFWYE
SSQLAAKQRAQQNKKAEEKKQELEEFIRRFSANVAKSKQATSRKKMIDKLNLSDIKPSSR
RYPAIIFDTEREAGDQILNVENLSASIDGEVLFKNVDLNMAKGDKVVIFSKDSRATSAFY
EILNGNMTPDSGTFDWGITTNQSYLPADNHSFFENDLTLVDWLRQWAKTEEERDEVYVRG
FLGKMIFSGEEALKTGRVLSGGEKVRCMLSRMMMMRANVLMLDEPTNHLDLESITAFNNS
LKNFKGSILFTTHDHEFAQTVANRVLEITPKGVIDRYTTFDEYLEDEKIQELRKKMYS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatttcaaatttatcagtacaatttggtaagcgaattttattcgacgaagta
aatacaacctttacacaaggtaattgctacggaattattggcgctaatggtgctggaaaa
tctacatttcttaaaataattgcaggcgaaatagatccaacttcgggtcgtgttatccta
gaaccaggaaaacgtatgtcggttctaaaccagaatcataatatgtttgatgatcttacg
gttcttgaaacagtgatgatgggaaataaggttttgtttgctgtaaaaaaagaaatggat
gacttgtatgcagattataccgatgcaaatgcagatagaataggagagttacaagttcgt
tttgaagaaatgaatggttggaatgccgaatctgatgcaggtgcaatgctttctaatctt
ggaatttctgccgattatcattatactttaatgggcgatatggaaggaaaattgaagctt
cgtgttttgttagcacaagccttatttggtaatcctgatgtgctaattatggatgagcct
accaacgacctggattttgaaaccataggttggttagaaaatttcttggcaaattacgaa
aatacagttttagtagtttctcacgacagacactttttagattcagtttgtacacacgtt
tccgatatcgattacggaaaaataaaccattactcaggaaattatactttctggtacgaa
tcatctcagttagctgcaaaacaaagagcacagcaaaataagaaagccgaagaaaagaaa
caagaattagaagaatttattcgtcgttttagtgccaatgttgcaaaatctaaacaagcc
acttctcgtaaaaaaatgatcgataaattaaatttatcagatataaaaccttcctctcgc
cgttatccagctattatttttgataccgaacgtgaagcaggagatcagattttgaatgtt
gaaaacctaagtgcttcaatagatggtgaggttttatttaaaaacgtagatttgaatatg
gcaaaaggagataaagtagttattttctcgaaagattctcgtgctacttcagctttttac
gaaatacttaacggaaatatgactcctgattctggtactttcgattggggaattacaacc
aaccaatcctatttgccagcagacaatcacagtttttttgaaaatgatttgacactcgta
gactggttgcgccaatgggcaaaaaccgaagaagagcgtgacgaagtttatgtacgtggt
ttcctaggaaaaatgattttttctggcgaagaagccttaaaaactggtcgggttttatct
ggaggagaaaaagtacgttgtatgttatctcgcatgatgatgatgcgtgccaatgtgttg
atgcttgatgaaccaactaatcacttagatttagagtcgattacagcgtttaacaactcg
ttaaaaaactttaaagggtcgatattatttaccacacatgaccatgagtttgcacaaact
gttgccaatcgtgtgttagaaattacaccaaaaggagtgatagaccgttataccactttt
gatgaatatctggaagatgagaaaattcaggaattaagaaagaaaatgtattcttag

DBGET integrated database retrieval system