KEGG   Flavobacterium psychrophilum JIP02/86: FP1048Help
Entry
FP1048            CDS       T00548                                 

Gene name
tal
Definition
(RefSeq) Transaldolase
  KO
K00616  
transaldolase [EC:2.2.1.2]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FP1048 (tal)
Enzymes [BR:fps01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     FP1048 (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1143630..1144286
Genome map
AA seq 218 aa AA seqDB search
MKFFIDTANLAQIKEAQALGVLDGVTTNPSLMAKEGITGKNNILKHYVDICNIVEGDVSA
EVNAMDYDGMIREGEELAELHDQIVVKLPMTKEGIMACKYFSDRGIRTNVTLIFSAGQAL
LAAKAGATYCSPFIGRLDDISTDGLNLIQEIRDIYDNYGFETQILAASVRHTMHVVNCAK
IGADVMTGPLSSILGLLKHPLTDIGIAQFIADFEKGNR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttatagacacagcaaatcttgcacaaataaaagaagcacaagcacttggt
gttcttgatggcgttacgacaaatccgtcgcttatggccaaagaaggaattacgggaaaa
aataacattttgaagcattatgttgatatttgtaatattgtagaaggtgatgttagtgcc
gaagtaaatgccatggattatgacggaatgattcgtgagggcgaagaattagctgaatta
cacgatcaaattgtggtaaaattgcctatgactaaagaaggaattatggcttgtaaatat
ttttctgataggggaattagaacaaatgttactttaattttctcggctggacaagcgctt
ttagcggcaaaagcgggggcaacttattgttcgccatttataggacgattagatgatatt
tctactgatggtttaaatttgattcaggaaattcgtgatatttatgacaattatggtttt
gaaacgcaaattcttgcagcatcagttaggcatactatgcatgtggttaattgtgccaaa
attggtgctgatgttatgactggacctttgtcatctattttaggtttgctaaaacatcct
ttgacagatattggaattgcacagtttattgccgattttgagaaaggaaatagatag

DBGET integrated database retrieval system