KEGG   Flavobacterium psychrophilum JIP02/86: FP1051Help
Entry
FP1051            CDS       T00548                                 

Definition
(RefSeq) Putative glutamine cyclotransferase
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1141104..1142156)
Genome map
AA seq 350 aa AA seqDB search
MKKYKTLVITSLTFIFIGCGDKNNSKNLFSIDESKFKSMFHNSDTINLTLKNEANKTIDS
VTYYNNDTKIGTAKGNSSFNFSLINQKIGYQNLKAVAHFEGLKEENSTRIEMLSSIEPKI
LTYKLLNTYPHNIDSFTEGLEFYGDYLYESTGQKGSSYFVKTDHKTGKTLQKTILDSKYF
GEGITFINGKMYQLTWQEATGFIYDANTLKLEKTFQFDKNIEGWGMTNDKKYIYQSDGTE
KIWKMNPENQKMISFINVYTNTSKIKKINELEWIDQKIYANIWEKDAIIIINPLTGAVEA
LVDLSGLRKLAKVSDADTLNGIAYNPRTKTIFVTGKNWDKMFEIKIDYSH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataaaacattagtaatcacatcattaacctttatttttattggttgtggg
gataaaaataattctaaaaatttattttctatcgatgaaagtaagtttaaatcgatgttt
cacaatagtgatacaattaatctaacattaaaaaacgaagcaaataaaacaatagattcc
gtaacttattataataatgacacaaaaattggtactgcaaaaggcaattcctcttttaat
ttttcattgattaatcaaaaaataggctatcaaaacctaaaagctgtagcgcattttgaa
ggattaaaagaagaaaattcgacaagaatagaaatgctttcaagtatagaacccaaaata
ttaacctataaacttttaaatacttacccgcacaacatagattcatttacggagggttta
gagttttatggtgactatttgtatgaaagtacaggtcaaaaaggatcctcttattttgta
aaaacagatcataaaacaggtaaaacattacaaaaaacaattttagactctaaatatttt
ggagaaggaattacttttattaatggaaaaatgtaccagttaacttggcaagaagcaaca
ggttttatttacgatgccaatactttaaaactagaaaaaacatttcaatttgataaaaat
atagaaggttggggtatgacaaacgacaaaaaatatatttatcaatctgacggaaccgag
aaaatctggaaaatgaatcccgaaaatcaaaaaatgattagttttataaatgtatatact
aacactagtaagattaaaaaaataaacgaactagaatggattgaccaaaaaatatatgcc
aatatctgggaaaaagatgctatcataatcataaatcctttaacaggtgctgttgaagca
cttgtagatttatctggtttaagaaagttagcaaaagttagcgatgccgatactttgaac
ggtattgcttacaatcctagaaccaaaaccatttttgtaactggaaaaaactgggacaaa
atgtttgaaataaaaatagactattcgcattag

DBGET integrated database retrieval system