KEGG   Flavobacterium psychrophilum JIP02/86: FP1053Help
Entry
FP1053            CDS       T00548                                 

Gene name
holA
Definition
(RefSeq) Probable DNA polymerase III, delta subunit
  KO
K02340  
DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FP1053 (holA)
   00240 Pyrimidine metabolism
    FP1053 (holA)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FP1053 (holA)
   03430 Mismatch repair
    FP1053 (holA)
   03440 Homologous recombination
    FP1053 (holA)
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FP1053 (holA)
DNA replication proteins [BR:fps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FP1053 (holA)
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     FP1053 (holA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1139281..1140285
Genome map
AA seq 334 aa AA seqDB search
MDEVLKIINDIKAGNIKPIYFLMGEEPYYIDKLSEYIEKNILQEHERDFNQTVLYGRDVT
IEDVVSNAKRYPMMADRQVVIVKEAQDLIRTIDKLESYAENPQPTTVLVICYKYKTLDKR
KKITKILAQKGVVYESKKLYENQVGEWLKRVLSGKKLNIEPKASAMLVDFLGTDLSKIAN
ELDKLAIILPQGSTITPAIIEENIGFSKDFNIFEFRKAIGERNQLKSYKIADHFAQNPKD
NPMVVTTSLVFSFFIQLLKYHGLKDKNPKTVAPILGVSPFFLKDYDIALRNYPMKKVSQI
VASLRDIDVKSKGVGANALPQSDLLKEMLVKIFN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggtactaaaaataattaacgatataaaagctggaaatataaaacctatttat
tttttaatgggcgaagagccttattatattgataaattgtctgaatatatcgaaaaaaat
attctgcaagagcatgaaagagattttaatcagacggttttatatggtcgtgatgttacg
attgaagacgtagtttcgaatgcaaaacggtatccaatgatggcagatcgtcaggttgtc
attgtaaaagaagctcaggatttaattcgaacaatagataaattagaatcttatgccgaa
aaccctcagccaacaactgttttagttatttgttataagtataaaactttagacaaacgc
aagaaaataactaaaatattagctcaaaaaggggtggtttacgagagtaaaaaattatac
gaaaaccaagtaggtgagtggctaaagcgagttttgtcaggaaaaaaattaaatatagag
cctaaagcatctgccatgttggtcgattttctaggaaccgatttgagcaaaattgccaac
gaattggataaattagccattatattaccacaaggaagtactattacaccagctattatt
gaagaaaatataggttttagtaaagattttaatatatttgaatttagaaaagccattggc
gagagaaatcaattaaaatcatacaaaattgccgaccattttgcgcaaaacccaaaggat
aatcctatggttgttacgacaagtttggtttttagcttttttattcaattgctaaagtac
catgggctaaaagacaaaaacccaaaaacggtggctcctatattaggtgtaagccctttt
ttcttaaaggattatgatattgctttgcgcaattatcctatgaaaaaagtgagtcaaatt
gtggcttctttacgtgatattgatgtaaaaagtaaaggtgttggtgcaaatgctttgcct
caatctgatttgttgaaagaaatgttggttaagatttttaattaa

DBGET integrated database retrieval system