KEGG   Flavobacterium psychrophilum JIP02/86: FP1057Help
Entry
FP1057            CDS       T00548                                 

Definition
(RefSeq) Hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1137260..1137400
Genome map
AA seq 46 aa AA seqDB search
MSRNTEKNIKKHNDKLHKAQDKVKKAKTDRAAQLKAIVKKFNEQKE
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaacaccgaaaagaatatcaaaaagcacaatgataagttgcacaaagctcag
gataaggtaaaaaaagcaaaaacagatagagctgcacaactaaaagcaatcgtaaaaaaa
tttaatgagcaaaaagaatag

DBGET integrated database retrieval system