KEGG   Flavobacterium psychrophilum JIP02/86: FP1059Help
Entry
FP1059            CDS       T00548                                 

Gene name
adeC
Definition
(RefSeq) Adenine deaminase
  KO
K01486  
adenine deaminase [EC:3.5.4.2]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FP1059 (adeC)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     FP1059 (adeC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1134905..1136527)
Genome map
AA seq 540 aa AA seqDB search
MQIQGQIVDIENKRIYSGEITIQNGKIISIIEKNHEVKNYILPGFIDAHIHIESSMLVPS
EFAKIAVLHGTVATISDPHEIANVLGKKGVYYMIENGKQVPLKFHFGAPSCVPATAFETA
GAIIDSEEIKELMASPDIYYLSEMMNYPGVLFDDDEVLKKIAWAKHFNKPIDGHAPGLRG
EPIKKYISAGITTDHECFTYSEAQEKLSLGMKVIIREGSAAKNFEALIDLLPANYENMMF
CSDDKHPDDLILGHINLLCARAVAKGIDVFKILQVACVNPVHHYKMKVGLLKKNDAADFI
VVEDLVNFKVNKTYINGELVAENGQSFVENINFETPNNFNITKKKISDFEIPSLAEKIRV
IEALEGQLITNEIHHNSFIKNGKLVSDIENDILKMAVVNRYQNTTPAIAFIKNFGLKKGA
IASSVAHDCHNIVVVGTSDEEICNAVNLIIKNTGGICAVNGTQNKSLALPVAGIMSDKDA
WETGKLYQEIDAMAKDLGSTLKAPFMTLSFMALLVIPDLKLSDKGLFSGNTFSFVDLNVE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcaaggacaaattgtagatatagaaaacaaacgaatttattccggtgaaatt
actattcaaaatggtaaaatcatatcaataattgagaaaaatcatgaggtaaaaaactat
attcttccaggatttattgatgcacatattcatatcgaaagttctatgcttgttccttca
gaatttgcaaaaattgctgtcctacacggaaccgttgctaccatttctgatccgcacgaa
attgccaatgtactgggaaaaaaaggggtttattatatgattgaaaacggaaaacaagta
ccgttaaaatttcattttggagcgccatcttgtgttcctgcaacggcctttgaaactgct
ggtgccatcatcgattctgaagaaattaaagaattgatggcttctcctgatatttattat
ttgtcggaaatgatgaattatcctggagttttatttgatgatgacgaagttttaaaaaaa
attgcttgggcaaaacatttcaacaaacctattgatggtcacgcaccaggattgcgagga
gaacctatcaaaaaatatatttcggcaggaattacaaccgatcacgagtgctttacttat
agcgaagcacaagaaaaattatctcttggtatgaaagttattattcgggaaggaagtgct
gcaaaaaactttgaagccttaatagatttacttccagcaaattacgaaaacatgatgttt
tgttccgatgacaaacaccctgatgatttgattttaggacacattaatttactgtgtgcc
agagcggttgccaaaggaattgatgtttttaaaatcttgcaagtggcttgtgtaaatcca
gttcatcattacaaaatgaaggtgggtttgttgaaaaaaaatgatgcagccgattttatt
gttgtagaagatttagtcaattttaaagtcaataaaacttatataaatggtgaattggtt
gccgaaaacggacaatcatttgtagaaaatattaattttgaaacgccaaataactttaat
attaccaaaaagaaaattagtgatttcgaaattccaagtttagcagaaaaaattagagtc
attgaagctttagaaggacagttaattaccaatgaaattcatcacaattcatttattaaa
aacggaaaattagtttcagatatagagaatgatattctgaaaatggcagttgtaaatcgt
tatcaaaatacaactccagcaattgcttttattaagaattttggtttaaaaaaaggtgct
attgccagttctgtagcccatgattgccataatattgtagtcgttggaacatcggacgaa
gaaatttgcaatgctgttaatttgattatcaaaaatactggcggaatttgcgctgtaaat
ggtactcaaaataaatcattagccttaccagttgcaggaattatgagtgataaagatgct
tgggaaacggggaaattgtaccaagaaattgatgccatggcaaaagatttggggagtacg
ctaaaagcgccatttatgacactttcgtttatggcactgctagtaattcctgatttgaag
ctatctgacaaaggattgtttagtggaaatacgttctcgtttgttgatttgaatgtagaa
taa

DBGET integrated database retrieval system