KEGG   Flavobacterium psychrophilum JIP02/86: FP1066Help
Entry
FP1066            CDS       T00548                                 

Gene name
porX
Definition
(RefSeq) Probable two-component system response regulatory protein containing PglZ domain PorX
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1127475..1129028)
Genome map
AA seq 517 aa AA seqDB search
MNSIKILWVDDEIDLLKPHILFLEKKNYIITTCNNGRDAVDIFQEENFDIVFLDENMPGM
SGLETLAEIKEKKSSIPVIMITKSEEEHIMEEAIGSKIADYLIKPVNPNQILLSLKKNLD
HSRLISEKTTLDYQKEFRKISMEMNMVNSYEDWVEFYKKLIFWELELENIDDQNMFQILE
SQKAEANNLFGKFIEKNYEDWFEPKADKPVQSHDLFKKLVIPELKKEENVLFVVIDNLRY
DQWKAFENVVNNHYKLESEVPYFAILPTATQYARNAIFSGLLPSEMEKQFPQYWKNDTED
GGKNLYEAEFLTAQLKRNGLNIEQEYFKITNLNNGKKLAENFKSLKDKKLVTVVYNFIDM
LSHAKTDMDVVKELASDDKAYRSLTLSWFKNSPLLEIIQQAQKLGFKLIITTDHGTINCK
NPSKVIGDKNTSLNLRYKTGRSLTYENKEVYAVKDPKKIGLPSINMTSIYIFAKNDIFLA
YVNNYNHYVSYYRNTYQHGGISLEEVIVPFLVFSPKK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcattaaaatactttgggtagacgacgaaatcgatttgctaaagccacatatt
ttatttctagaaaagaaaaattatatcataactacttgtaataacggccgtgatgcggta
gatatatttcaagaagaaaattttgatatagtttttcttgatgaaaatatgcctggaatg
tcagggttagaaacccttgcagaaataaaagaaaaaaaatcttcaatacctgtaatcatg
attacaaaaagtgaagaagaacatatcatggaagaagcaattggaagtaaaattgcagat
tatttgataaaacctgtcaatccgaatcaaattttattgagtttaaagaaaaatttagac
cactcgcgtttaatttctgaaaaaacaacactagattaccagaaagaattccgtaaaatt
tctatggagatgaatatggtcaattcctatgaagattgggtagaattttataaaaaatta
atcttctgggagcttgaattagaaaatattgatgaccaaaatatgtttcaaattctagaa
tctcaaaaagcagaagccaataatttatttggaaaatttatcgaaaaaaattatgaagac
tggttcgaaccaaaagccgacaagccagtacaatctcacgatttatttaaaaaattagtt
attccagaacttaaaaaagaagaaaatgtactttttgttgtaatcgataacttgcgttat
gaccaatggaaagccttcgaaaacgttgtaaacaatcattacaaactagaaagtgaagtc
ccttattttgccattttgccaacagccacacaatatgctcgaaatgcaattttttcgggt
ttactaccctcggaaatggaaaaacaatttccacaatactggaaaaatgataccgaagat
ggagggaaaaacctttacgaagcagaatttcttaccgcacagctaaaacgaaatggttta
aatatcgaacaagaatatttcaaaataaccaatctaaataacggaaaaaaattagcagaa
aattttaaatcattaaaagacaaaaaattagttaccgtagtttataactttatcgatatg
ctatcgcatgctaaaaccgatatggatgtagtaaaagagttagcatcagatgacaaagca
taccggtcattaaccttaagctggtttaaaaattctccattactagaaataattcaacaa
gctcaaaaactaggcttcaaactaattataaccacggatcacggaacaataaattgcaaa
aatccgtctaaagttataggagataaaaatacaagtttaaacttacgttacaaaactggc
cgtagtttaacttacgaaaacaaagaagtatacgcagtaaaagatcctaaaaaaattggt
ttaccatctataaatatgacaagtatttatatttttgcaaaaaatgatatttttttagct
tatgtaaataattacaatcattatgtaagttattaccgaaatacttaccaacacggagga
atttcgctcgaagaagttattgtaccatttttagtatttagcccaaaaaaataa

DBGET integrated database retrieval system