KEGG   Flavobacterium psychrophilum JIP02/86: FP1069Help
Entry
FP1069            CDS       T00548                                 

Definition
(RefSeq) Probable transmembrane protein of unknown function
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1125312..1125686)
Genome map
AA seq 124 aa AA seqDB search
MKFSYRLSYYLFGFLVGCIFLFFVLNKKNTRCTYFPNDRVLNNLRSKPFYYSNVASKELA
EDWLDTIDVKNTLQYGDVDFSRSNLKISKGKLYTIIGKTIKNQPIEVIVENYEDKVVLKE
VKKQ
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcttacagactaagttattatctttttggattccttgtgggttgcatattt
ttattttttgtattaaataaaaaaaatacccgttgtacttattttcctaatgatagggtt
ttaaataatttaagatcgaaaccattttattactctaatgtagcatcaaaagaattagcg
gaagattggttagataccatcgatgtaaaaaacactttacaatatggcgatgtagatttt
agcagaagcaatcttaaaatatcgaaaggcaaattatatacgataattggcaaaaccatt
aaaaatcaacctattgaagttatagtggaaaattatgaagacaaggtagttttaaaagaa
gtaaaaaaacaataa

DBGET integrated database retrieval system