KEGG   Flavobacterium psychrophilum JIP02/86: FP1300Help
Entry
FP1300            CDS       T00548                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FP1300 (recR)
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FP1300 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418962..2419582)
Genome map
AA seq 206 aa AA seqDB search
MEFSSKLLEKAVNEMAQLPGIGKRTALRLVLYLLKQPKDRTDFLAQSLLTMREGIIFCEN
CHNISDVAVCEICSNKNRNHQIVCVVEDVRDVMAIENTGQFRGVYHVLGGKISPIDGVGP
SQLNISSLVEKVKSGSVSEIIFALSSTMEGDTTNFYIYKQIKDCEIITSSIARGISVGDE
LEYADEVTLGRSILNRIPFENSFKNN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcatcaaaactattagaaaaagcggtaaacgaaatggctcaattaccagga
attggaaaacgaacggctttacggttagtattgtatttgctaaaacaacccaaagatcga
acagattttttggcacaatctttacttactatgcgtgagggaattatattttgtgaaaat
tgccacaatatttccgatgttgcagtatgcgaaatttgttcaaataagaatagaaaccat
caaattgtttgtgttgtagaagatgttcgtgatgtaatggcaattgaaaatacaggtcag
tttcgaggtgtttatcacgttcttggtggaaaaatttcacccatagatggtgttggtcca
agtcagttaaacatatcgtccttagtagaaaaagtaaaatcaggaagtgtttcggagata
atttttgcactaagttcaacaatggaaggcgatacaactaatttttatatttataagcaa
ataaaagattgtgagataattacctcatctattgctcgtggaatatcagtgggagatgag
ttagaatatgcagatgaagtaactcttggacgaagtattttaaacagaattcctttcgag
aattcttttaaaaataattaa

DBGET integrated database retrieval system