KEGG   Flavobacterium psychrophilum JIP02/86: FP1384Help
Entry
FP1384            CDS       T00548                                 

Gene name
pdhC
Definition
(RefSeq) Pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00010  Glycolysis / Gluconeogenesis
fps00020  Citrate cycle (TCA cycle)
fps00620  Pyruvate metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Module
fps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FP1384 (pdhC)
   00020 Citrate cycle (TCA cycle)
    FP1384 (pdhC)
   00620 Pyruvate metabolism
    FP1384 (pdhC)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FP1384 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H KH_1
Motif
Other DBs
NCBI-GeneID: 5298904
NCBI-ProteinID: YP_001296276
UniProt: A6GZE4
Position
complement(2494244..2495872)
Genome map
AA seq 542 aa AA seqDB search
MATVITMPRLSDTMTEGTVAAWLKKVGDKISEGDILAEIETDKATMEFESFNSGTLLYIG
IPEGESAPVDSLLAIIGNEGEDISGLLNGDTVSLIKEEKAEIAPVANTQDLKPETTLPKG
VVVVTMPRLSDTMTDGTVATWLKKVGDKVAEGDILAEIETDKATMEFESFNAGTLLFVGI
QEGESAPVDSVLAIIGPEGTNIAGIAENYKKVGNVTPEASEPVAEKAVEVSNPTSNNQNS
SSNPTDRIFASPLAKKIAQDKGINLSQVKGSGENGRIIKEDVARFAIESQKPKVESQPTT
KTQGASPVTQFVPAGEKFSEEIKNSQMRKTIAKRLSESIFTAPHFYLTIEIAMDEAMKSR
ATINTIPDTKVSFNDMVVKACAMALKKHPQVNSQWREDAMIINHHVNIGVAVAVEDGLVV
PVLNFTDQMSLTQIGSSVRDLAGKAKTKKLTPAEMDGSTFTVSNLGMFGITEFTSIINQP
NSAILSVGAIVEKPVVRNGQIVVGNTMKVTLACDHRTVDGATGAQFLQTLKQFVENPVTM
LA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtaatcacaatgcctcgtctaagcgatacaatgaccgaaggaacagtagca
gcttggttaaaaaaagtaggcgataaaatttcagaaggcgatattcttgccgaaattgaa
acagataaagcaactatggaatttgaatcattcaattcaggaacgcttttatacatagga
ataccagaaggagaatctgcaccagtagattcgcttttagccattataggaaacgaagga
gaagatatttcaggattattaaacggcgatacagtaagtttaataaaagaagaaaaagca
gaaattgctccagttgctaatacccaagatttaaaaccagaaaccactttgccaaaagga
gttgtagtagttacaatgccaagactttcagacacaatgactgacggaactgttgcaact
tggttaaaaaaagtaggtgataaagttgccgaaggcgatattcttgccgaaatagaaaca
gataaagctacgatggaatttgagtctttcaatgcgggtactttattgttcgtagggatt
caagaaggagaatctgccccagtagatagcgttttagctattataggaccagagggaact
aatattgcaggtattgccgaaaattataaaaaagttggaaatgttactcccgaagcttcg
gaaccagttgctgaaaaagctgtcgaagtttctaatccaacatcaaataaccaaaattca
tcatctaatccaacggatagaattttcgcttcgccattggctaaaaaaattgctcaagat
aaaggaattaacttatctcaagtaaaaggttctggagaaaacggaagaattataaaagaa
gatgtagcacgttttgcaatcgaaagtcaaaaaccgaaagtagaaagccaaccaactaca
aaaacacaaggcgcaagccctgtaacccaatttgttcctgctggagaaaaattctctgaa
gaaataaaaaattcgcaaatgcgtaaaaccattgcaaagcgattatcagaatctatattt
acagcacctcatttctatttaactatcgaaattgcgatggacgaagctatgaaatctcgt
gccacaataaatacaattcctgatacaaaagtatcgtttaacgatatggttgtcaaagct
tgtgcgatggctttaaagaagcacccgcaagtaaactctcaatggagagaagacgccatg
attattaatcatcatgtaaatattggagttgccgtagctgttgaagacggattagtagtg
ccagttttaaactttacagatcaaatgagtttaactcaaattggatcaagtgttcgtgat
ttagcgggaaaagctaaaactaaaaaattaacacctgccgaaatggacggaagtacattt
acagtatctaatcttggaatgtttggtattaccgaatttacatcaataataaatcaaccc
aattcagcaattttatctgtaggtgctattgtagaaaaaccagtagttagaaacggtcaa
attgtagttggaaacactatgaaagtaacccttgcttgcgatcacagaactgtcgatggg
gcaacgggagcacaattcttacaaacattaaaacaatttgttgaaaatccagtaactatg
ttggcttaa

DBGET integrated database retrieval system