KEGG   Flavobacterium psychrophilum: FP1417Help
Entry
FP1417            CDS       T00548                                 

Gene name
bsaA
Definition
Glutathione peroxidase BsaA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fps  Flavobacterium psychrophilum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FP1417 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FP1417 (bsaA)
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FP1417 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620999..621592
Genome map
AA seq 197 aa AA seqDB search
MKQLLCLFSLMILMTCKSQETNIKNQSSSEKQKTTKMVRESIYQFKVIDIEGKEFDFSSL
KGKKIMIVNTASECGLTPQYKQLQELYTQFKGKNFVIIGFPANNFGHQEPGANVAIATFC
SKNYGVTFPMMEKISVKGDDMHILYQFLTQKAKNGLEDNEVQWNFQKYLIDTTGHLVKVI
APTTLPTDNEIVSWIKG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattactttgcctattttcattaatgatattaatgacttgtaaaagtcaagaa
acaaacattaaaaatcagtcttcttcagaaaaacaaaaaacaactaaaatggtacgagaa
tctatttatcagtttaaagtaattgatattgaaggaaaagaattcgatttttcttcatta
aaagggaaaaaaataatgattgtaaataccgcttcagaatgtgggctaaccccacaatat
aagcaattgcaagaattatatacacaatttaaaggcaaaaattttgtcattataggattt
cctgcaaataatttcggacaccaagaaccaggggctaatgttgcaattgctactttttgt
tctaaaaattatggtgtaacttttccaatgatggaaaaaatatctgtaaaaggtgatgat
atgcatatattgtaccaatttttaacccaaaaagctaagaatggtttagaggataatgag
gtacaatggaattttcagaaatatctgattgatacaacagggcatctcgttaaagttatt
gcgccaaccacattgcctacagataatgaaatagtaagttggattaagggttag

DBGET integrated database retrieval system