KEGG   Flavobacterium psychrophilum: FP1417Help
Entry
FP1417            CDS       T00548                                 

Gene name
bsaA
Definition
Glutathione peroxidase BsaA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fps  Flavobacterium psychrophilum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fps00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fps00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620999..621592
Genome map
AA seq 197 aa AA seqDB search
MKQLLCLFSLMILMTCKSQETNIKNQSSSEKQKTTKMVRESIYQFKVIDIEGKEFDFSSL
KGKKIMIVNTASECGLTPQYKQLQELYTQFKGKNFVIIGFPANNFGHQEPGANVAIATFC
SKNYGVTFPMMEKISVKGDDMHILYQFLTQKAKNGLEDNEVQWNFQKYLIDTTGHLVKVI
APTTLPTDNEIVSWIKG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattactttgcctattttcattaatgatattaatgacttgtaaaagtcaagaa
acaaacattaaaaatcagtcttcttcagaaaaacaaaaaacaactaaaatggtacgagaa
tctatttatcagtttaaagtaattgatattgaaggaaaagaattcgatttttcttcatta
aaagggaaaaaaataatgattgtaaataccgcttcagaatgtgggctaaccccacaatat
aagcaattgcaagaattatatacacaatttaaaggcaaaaattttgtcattataggattt
cctgcaaataatttcggacaccaagaaccaggggctaatgttgcaattgctactttttgt
tctaaaaattatggtgtaacttttccaatgatggaaaaaatatctgtaaaaggtgatgat
atgcatatattgtaccaatttttaacccaaaaagctaagaatggtttagaggataatgag
gtacaatggaattttcagaaatatctgattgatacaacagggcatctcgttaaagttatt
gcgccaaccacattgcctacagataatgaaatagtaagttggattaagggttag

DBGET integrated database retrieval system