KEGG   Flavobacterium psychrophilum JIP02/86: FP1429Help
Entry
FP1429            CDS       T00548                                 

Gene name
tpiA
Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FP1429 (tpiA)
   01230 Biosynthesis of amino acids
    FP1429 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FP1429 (tpiA)
   00051 Fructose and mannose metabolism
    FP1429 (tpiA)
   00562 Inositol phosphate metabolism
    FP1429 (tpiA)
Enzymes [BR:fps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FP1429 (tpiA)
Exosome [BR:fps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FP1429 (tpiA)
  Exosomal proteins of bladder cancer cells
   FP1429 (tpiA)
  Exosomal proteins of melanoma cells
   FP1429 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(608028..608780)
Genome map
AA seq 250 aa AA seqDB search
MRAKIVAGNWKMNKNSEETEDLINELIDKLPTNSNAKIIIAPTFINLASAVDHTEFTNIR
VAAQNMHQAENGAYTGEISADMLKSIGVNTVILGHSERRAIFHETDAIISFKVDTALRHE
MTVIFCFGEELKDRQNKQHFNIVENQLRDGLFHIDKSAWANIILAYEPVWAIGTGETASP
EQAQEMHEFIRETVRKVFGSDIAEDVSILYGGSVKPDNAKEIFSKPDVDGGLIGGAALKA
DDFVVIVNGI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaaaaattgtagctggaaactggaaaatgaataaaaattcggaagaaaccgaa
gatttaattaatgaattaatagataaattaccaaccaatagtaatgctaaaataattatt
gcaccaacttttataaatcttgcttcggctgtagaccataccgaatttactaatattcgt
gtggcagcacaaaatatgcaccaagcagaaaatggcgcttatactggtgaaatttctgca
gatatgctaaaaagcattggagtaaatactgtaatccttggccattcggaacgaagagct
atctttcatgaaactgatgctataatttcgtttaaagtagatacggctttaagacacgag
atgactgttatattttgttttggagaagaattgaaagaccgtcaaaacaaacaacatttc
aatatcgttgaaaaccaattgcgtgacggattatttcatatagataaatccgcttgggca
aatattattttggcttacgaacccgtttgggcaataggaacaggcgaaactgcaagtcca
gaacaagcgcaagaaatgcacgaatttattagagaaactgttcgcaaagtttttggaagt
gatattgccgaagatgtttctattctttatggtggtagtgtaaaacctgacaatgctaaa
gaaattttctctaaacccgatgttgatggcggattaataggaggagcagcattaaaagct
gatgattttgtagttatcgtaaatgggatataa

DBGET integrated database retrieval system