KEGG   Flavobacterium psychrophilum JIP02/86: FP1614Help
Entry
FP1614            CDS       T00548                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FP1614 (pfkA)
   01230 Biosynthesis of amino acids
    FP1614 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FP1614 (pfkA)
   00030 Pentose phosphate pathway
    FP1614 (pfkA)
   00051 Fructose and mannose metabolism
    FP1614 (pfkA)
   00052 Galactose metabolism
    FP1614 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    FP1614 (pfkA)
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FP1614 (pfkA)
Protein phosphatases and associated proteins [BR:fps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FP1614 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425077..1426063)
Genome map
AA seq 328 aa AA seqDB search
MPKTIKKIGVLTSGGDAPGMNAAIRSVVRTCAYHNIDCIGIYRGYQGMIEGDFEEMGPRS
VNNIVNKGGTILKSARSKEFMTAQGRQKAHKHLINSNIDALVVIGGDGTFTGAEIFNNEF
NYPVIGIPGTIDNDIYGTSHTLGYDTALNTVVEVIDKIRDTASSHNRLFFVEVMGRDAGH
IALNAGIGAGAEEILIPEENLGLDRLLESLQKSKTSGKSSSIVVVSEGDKIGKNVFELKD
YVEENLPEYDVRVSVLGHMQRGGAPSCFDRVLASRLGVKAVESLLEGKSNYMVGLFQDKV
SLTPLEQAIKAKSQIDKELLRVSEIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaacaataaaaaaaataggagttttaacctcaggaggcgatgcaccaggaatg
aatgccgctatccgatctgtagttcgcacatgtgcttaccataatatagactgtatagga
atataccgtggttatcagggaatgatagaaggcgattttgaagaaatgggaccacgttct
gtaaataatatcgtaaataaaggaggaacaatcctaaaatcagcccgctctaaagaattt
atgacagcgcaaggtaggcaaaaagcgcacaaacaccttatcaattcgaatatcgatgcc
ctagtagtcattggaggggacggaacatttacaggagccgaaatctttaataacgaattt
aattaccccgtaattggaattcccggcacaatagacaatgatatttatggtaccagccat
actttaggttacgataccgctctaaacacagttgtagaagtcatcgataaaattagagat
acagccagttctcataaccgattattttttgtagaagttatggggcgagatgcagggcat
atagcactaaatgcaggcattggcgcaggagcagaggaaatcttaatcccagaagaaaat
ttaggattagacagactattagaatccctacaaaaaagtaaaacatcaggaaaatcatca
agtattgtagtagtttcagaaggagataagataggcaaaaacgtattcgaactaaaagat
tatgtcgaagaaaacttgccagaatacgatgttcgagtatcggtattaggacacatgcag
cgtggtggtgcaccatcgtgtttcgacagagttctagcttctcgtttgggggtaaaagca
gtcgaatcattactagaaggaaaatctaattacatggtaggattgtttcaagataaagta
tcattaacaccattagaacaagccattaaagcaaaatcacaaatagacaaagaattatta
agagtatcagaaattatgtccacataa

DBGET integrated database retrieval system