KEGG   Flavobacterium psychrophilum JIP02/86: FP1614Help
Entry
FP1614            CDS       T00548                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00010  Glycolysis / Gluconeogenesis
fps00030  Pentose phosphate pathway
fps00051  Fructose and mannose metabolism
fps00052  Galactose metabolism
fps00680  Methane metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
fps01230  Biosynthesis of amino acids
fps03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FP1614 (pfkA)
   00030 Pentose phosphate pathway
    FP1614 (pfkA)
   00051 Fructose and mannose metabolism
    FP1614 (pfkA)
   00052 Galactose metabolism
    FP1614 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    FP1614 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FP1614 (pfkA)
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FP1614 (pfkA)
Protein phosphatases and associated proteins [BR:fps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FP1614 (pfkA)
Messenger RNA biogenesis [BR:fps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FP1614 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5300332
NCBI-ProteinID: YP_001296490
UniProt: A6H008
Position
complement(1425077..1426063)
Genome map
AA seq 328 aa AA seqDB search
MPKTIKKIGVLTSGGDAPGMNAAIRSVVRTCAYHNIDCIGIYRGYQGMIEGDFEEMGPRS
VNNIVNKGGTILKSARSKEFMTAQGRQKAHKHLINSNIDALVVIGGDGTFTGAEIFNNEF
NYPVIGIPGTIDNDIYGTSHTLGYDTALNTVVEVIDKIRDTASSHNRLFFVEVMGRDAGH
IALNAGIGAGAEEILIPEENLGLDRLLESLQKSKTSGKSSSIVVVSEGDKIGKNVFELKD
YVEENLPEYDVRVSVLGHMQRGGAPSCFDRVLASRLGVKAVESLLEGKSNYMVGLFQDKV
SLTPLEQAIKAKSQIDKELLRVSEIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaacaataaaaaaaataggagttttaacctcaggaggcgatgcaccaggaatg
aatgccgctatccgatctgtagttcgcacatgtgcttaccataatatagactgtatagga
atataccgtggttatcagggaatgatagaaggcgattttgaagaaatgggaccacgttct
gtaaataatatcgtaaataaaggaggaacaatcctaaaatcagcccgctctaaagaattt
atgacagcgcaaggtaggcaaaaagcgcacaaacaccttatcaattcgaatatcgatgcc
ctagtagtcattggaggggacggaacatttacaggagccgaaatctttaataacgaattt
aattaccccgtaattggaattcccggcacaatagacaatgatatttatggtaccagccat
actttaggttacgataccgctctaaacacagttgtagaagtcatcgataaaattagagat
acagccagttctcataaccgattattttttgtagaagttatggggcgagatgcagggcat
atagcactaaatgcaggcattggcgcaggagcagaggaaatcttaatcccagaagaaaat
ttaggattagacagactattagaatccctacaaaaaagtaaaacatcaggaaaatcatca
agtattgtagtagtttcagaaggagataagataggcaaaaacgtattcgaactaaaagat
tatgtcgaagaaaacttgccagaatacgatgttcgagtatcggtattaggacacatgcag
cgtggtggtgcaccatcgtgtttcgacagagttctagcttctcgtttgggggtaaaagca
gtcgaatcattactagaaggaaaatctaattacatggtaggattgtttcaagataaagta
tcattaacaccattagaacaagccattaaagcaaaatcacaaatagacaaagaattatta
agagtatcagaaattatgtccacataa

DBGET integrated database retrieval system