KEGG   Flavobacterium psychrophilum: FP2014Help
Entry
FP2014            CDS       T00548                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fps  Flavobacterium psychrophilum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fps00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fps00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1868065..1869372
Genome map
AA seq 435 aa AA seqDB search
MGTFKIEGGIRLKGEITPQGAKNEALQVLCPALLTSEKVRITNIPDIIDVNKLIVLLGNL
GVKIQKNGPGDYTFQADEVNIDYLKTEAFKKEGGSLRGSIMIVGPLLARFGCGYIPKPGG
DKIGRRRLDTHFEGFINLGAKFRYEREDHFYGVEVDGKLKGAYMLLDEASVTGTANIVMA
AVLAQGITTIYNAACEPYLQQLCKMLNSMGAKITGVGSNLLTIEGVDSLGGCEHRILPDM
IEIGSWIGLAAMTRSEITIKNVSWDNLGIIPNTFRKLGITLEKRGDDIYIPTHENYEIKT
DIDGSILTIADAPWPGLTPDLLSIILVVATQAKGDVLIHQKMFESRLFFVDKLIDMGAKI
MLCDPHRAVIMGHDFESQLKATTMSSPDIRAGISLLIAALTAKGTSIIQNIEQIDRGYER
IDERLRAIGANIVRE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggcacattcaaaatagaaggcggtatccgactaaaaggagaaatcacaccacaagga
gcaaaaaacgaagcgttgcaggttttatgtccagcattactaacttcggaaaaagttagg
ataactaatattccagacattattgatgtaaataaactaattgttttacttggaaattta
ggtgtaaaaattcaaaaaaatggccctggagattatacttttcaggctgatgaagtaaat
atagattatctaaaaaccgaagcttttaaaaaagaaggcggttcccttcgtggttcgatc
atgatcgttgggcctttattagcaagatttggttgcggatatattcctaaaccaggtgga
gataaaatagggagaagacgtttagacacacactttgaaggatttataaatcttggagct
aagtttagatacgaaagagaagaccatttttatggtgtagaagttgatggcaaactaaaa
ggtgcttatatgctactcgacgaagcatcggtaactggaaccgcaaatattgtaatggca
gctgttcttgcccaaggaattacaaccatatacaatgccgcttgcgaaccttacttacaa
caattatgtaagatgctaaactcgatgggggcaaaaataactggcgtaggatctaactta
ttaactatagaaggagtagattctcttggtggttgtgagcatagaatcttaccagacatg
atcgaaataggctcttggattggtcttgcggctatgacaagaagcgaaattaccatcaaa
aatgtgtcatgggacaatttaggtattattccaaatacttttagaaaattaggaattact
ttagaaaaaagaggcgatgatatttacattcctacacatgagaactatgaaataaaaacc
gatattgatggttcgattttgactattgccgatgcgccttggccaggattaacaccagat
ttattaagcattattcttgtagtggcaacacaagcaaaaggtgatgttttgatacaccaa
aaaatgttcgaaagtcgtttgttcttcgtagataaactaatagatatgggcgcaaaaatt
atgctttgcgacccgcacagagctgttattatgggacatgatttcgaatcgcaactcaaa
gcaaccacaatgtcatcgccagatattagagcaggaatttcgttgctaatcgctgcactt
actgcaaaaggaaccagtattatacaaaacatcgaacaaatagatcgtggttacgagcgt
atagatgaacgtttaagagccataggcgcaaatattgtaagagaataa

DBGET integrated database retrieval system