KEGG   Flavobacterium psychrophilum: FP2122Help
Entry
FP2122            CDS       T00548                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fps  Flavobacterium psychrophilum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FP2122 (ruvA)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FP2122 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1985043..1985624)
Genome map
AA seq 193 aa AA seqDB search
MIAHIQGKLVEKSPTEVVIDCNGVGYHVNISLHTYGLLPTTDFVKLFTHLIIKEDSHSLY
GFAEKSEKEIFKLLISVSGIGANIARTMLSSIEPKQIINAIGSGDVGTIQSIKGIGVKTA
QRTIIDLKEKVLKLYDLDQVSISQSNTNKDEALSALEVLGFIRKSAEKVVEKIVATMPDA
TVETIIKQALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacacattcaaggaaaattagtcgaaaaatcaccaacagaagttgtaatagat
tgcaacggtgttggttatcatgtaaatatttcgctgcacacttatggtttattgcctaca
accgattttgtaaagctttttacccatctaataataaaggaagatagtcattcgttatac
ggttttgccgaaaaatctgaaaaggaaatttttaaactgttaatttctgtttcgggaata
ggagccaatattgcacgcacaatgttatcatcaatagaacccaaacaaattattaatgcg
attggttctggcgatgtaggaacaattcagtctatcaaaggaattggagtgaaaactgcc
caacgaaccattatcgatctgaaagaaaaagtattaaaactttatgatttagaccaagtt
tctatctcacaaagcaatacaaacaaagatgaagcgttatctgcattagaagttctagga
tttatcaggaaatcggcagaaaaagtagtcgaaaaaatcgttgcaaccatgccagatgcc
accgtagaaactataattaaacaagccttaaaaaatttataa

DBGET integrated database retrieval system