KEGG   Flavobacterium psychrophilum: FP2335Help
Entry
FP2335            CDS       T00548                                 

Definition
Thioredoxin family protein precursor
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
fps  Flavobacterium psychrophilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2688346..2688918)
Genome map
AA seq 190 aa AA seqDB search
MNKFKYLLFLVPVAAVLLFSSFKYNQNTATTAITKKSTKEDLVWHTNVKEAIDLAKKEDK
PLFLFFTGSDWCGWCIRLQKEVFKTPEFEAWAKEKVVLVELDFPRRTEQTTELKDQNNQL
QQAFAVQGFPTVWFAKGTNKSGKINFEQLGSTGYVAGGPGAWLSGADQIIAKFVHDSKKE
SAAKRLKPKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttaaatatttactttttttagtaccagttgcggcggtactgttgttctct
agctttaaatataatcagaacacagcaacgacagcaataacaaaaaaaagcactaaagaa
gatttagtttggcataccaatgttaaagaagcgatcgatcttgctaaaaaagaagacaaa
cctttattcttgttttttacgggtagcgattggtgtggttggtgtattcgtttgcaaaaa
gaagtttttaaaactccagaatttgaagcctgggccaaagaaaaagtagttttagtcgaa
ttagatttccctagacgaacagagcaaacaaccgaattgaaagaccaaaacaatcaattg
caacaagcttttgctgttcaagggtttccaacagtttggtttgctaaaggtaccaataaa
tcaggaaaaataaatttcgaacaattgggaagcacaggatatgttgctggcggaccaggt
gcttggctttctggagcagatcaaattattgcaaaatttgttcatgattctaaaaaagaa
tcagccgcaaaacggctaaagccaaaaaaataa

DBGET integrated database retrieval system