KEGG   Flavobacterium psychrophilum JIP02/86: FP2409Help
Entry
FP2409            CDS       T00548                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FP2409 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP2409 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FP2409 (sucB)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FP2409 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765389..2766600
Genome map
AA seq 403 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVAVGAVVCHIDTDGEKPSGSAPVAEAPKAEVKVEAPKVAPVAQKTYAAQTPSPAA
RKILDEKNIQPSDVVGTGKGGRITTEDAVNAVPSMGTPTGGSRGSERTKLSMLRRKVAER
LVAAKNETAMLTTFNEVNMTPINNIRNQYKDAFKAKHNGVGLGYMSFFTKAVTRALQLFP
DVNSMMDGDYKVAYDFADISIAVSGPKGLMVPVVRNAELLTFRGVEAEIKRLAIRARDGQ
ITVDDMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIIERPIAVNGQVEIHPMMYV
ALSYDHRIIDGRESVGFLVAVKEALENPLELLLDNNPKKAFEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccatcaccaggggaatcaatcaaagaagttgaaatcgca
acttggttagtaaaagatggcgattatgtagaaaaagaccaagccattgccgaagtcgat
tcagacaaagcaacactagaattacccgcagaagcaagtggaatcattacactaaaagcc
gaagaaggtgatgccgttgccgttggcgctgtagtttgtcatattgatactgatggcgaa
aaaccatctggatctgctcccgttgccgaagccccaaaggcagaagtaaaagtagaagct
ccaaaagttgctccagtagctcaaaaaacctatgctgcacaaacaccttcccctgccgct
agaaagatattagacgaaaaaaacatacaaccatcagatgttgtaggaacaggaaaaggc
ggaagaattactaccgaagatgctgtaaatgcagtgccttctatgggaacgccaactggt
ggatctcgtggttcggaacgcacaaaactatctatgttgcgccgtaaagttgccgaaaga
ttagtcgctgctaaaaatgaaaccgctatgttaactacgttcaacgaagtaaacatgaca
ccaataaataacattcgtaaccaatacaaagacgcattcaaagcaaaacacaatggtgtt
ggtttaggttacatgtctttctttaccaaagccgtaactcgtgctttacaactttttcca
gatgttaactcgatgatggacggagattataaagtagcttacgattttgcagatatttct
atcgcagtttctggaccaaaaggattaatggttcctgtagttagaaatgcagaattatta
acttttcgtggtgttgaagccgaaattaaacgtttggcaattcgtgctcgtgacggacaa
atcactgttgatgacatgacgggtggaacatttaccattaccaatggtggtgtttttgga
agtatgttatctacaccaattatcaatccgccacaatctggaattttaggaatgcacaac
attatcgaacgtcctattgctgtaaatggtcaagtagaaattcacccaatgatgtacgta
gcactttcttatgatcaccgtattattgatggtcgtgagtcagttggtttcttagtagct
gtaaaagaagctttagaaaacccattagaattgcttttagataacaatcctaagaaagca
ttcgaattgtaa

DBGET integrated database retrieval system