KEGG   Flavobacterium psychrophilum: FP2409Help
Entry
FP2409            CDS       T00548                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fps01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fps00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fps00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2765389..2766600
Genome map
AA seq 403 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVAVGAVVCHIDTDGEKPSGSAPVAEAPKAEVKVEAPKVAPVAQKTYAAQTPSPAA
RKILDEKNIQPSDVVGTGKGGRITTEDAVNAVPSMGTPTGGSRGSERTKLSMLRRKVAER
LVAAKNETAMLTTFNEVNMTPINNIRNQYKDAFKAKHNGVGLGYMSFFTKAVTRALQLFP
DVNSMMDGDYKVAYDFADISIAVSGPKGLMVPVVRNAELLTFRGVEAEIKRLAIRARDGQ
ITVDDMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIIERPIAVNGQVEIHPMMYV
ALSYDHRIIDGRESVGFLVAVKEALENPLELLLDNNPKKAFEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccatcaccaggggaatcaatcaaagaagttgaaatcgca
acttggttagtaaaagatggcgattatgtagaaaaagaccaagccattgccgaagtcgat
tcagacaaagcaacactagaattacccgcagaagcaagtggaatcattacactaaaagcc
gaagaaggtgatgccgttgccgttggcgctgtagtttgtcatattgatactgatggcgaa
aaaccatctggatctgctcccgttgccgaagccccaaaggcagaagtaaaagtagaagct
ccaaaagttgctccagtagctcaaaaaacctatgctgcacaaacaccttcccctgccgct
agaaagatattagacgaaaaaaacatacaaccatcagatgttgtaggaacaggaaaaggc
ggaagaattactaccgaagatgctgtaaatgcagtgccttctatgggaacgccaactggt
ggatctcgtggttcggaacgcacaaaactatctatgttgcgccgtaaagttgccgaaaga
ttagtcgctgctaaaaatgaaaccgctatgttaactacgttcaacgaagtaaacatgaca
ccaataaataacattcgtaaccaatacaaagacgcattcaaagcaaaacacaatggtgtt
ggtttaggttacatgtctttctttaccaaagccgtaactcgtgctttacaactttttcca
gatgttaactcgatgatggacggagattataaagtagcttacgattttgcagatatttct
atcgcagtttctggaccaaaaggattaatggttcctgtagttagaaatgcagaattatta
acttttcgtggtgttgaagccgaaattaaacgtttggcaattcgtgctcgtgacggacaa
atcactgttgatgacatgacgggtggaacatttaccattaccaatggtggtgtttttgga
agtatgttatctacaccaattatcaatccgccacaatctggaattttaggaatgcacaac
attatcgaacgtcctattgctgtaaatggtcaagtagaaattcacccaatgatgtacgta
gcactttcttatgatcaccgtattattgatggtcgtgagtcagttggtttcttagtagct
gtaaaagaagctttagaaaacccattagaattgcttttagataacaatcctaagaaagca
ttcgaattgtaa

DBGET integrated database retrieval system