KEGG   Flavobacterium psychrophilum: FP2450Help
Entry
FP2450            CDS       T00548                                 

Gene name
dut
Definition
dUTP diphosphatase (EC:3.6.1.23)
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
fps  Flavobacterium psychrophilum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fps00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2816893..2817327)
Genome map
AA seq 144 aa AA seqDB search
MQIKIINKSQHELPNYETIGSAGMDLRANIQAPITLQPLERTLVKTGLFIELPISYEAQV
RPRSGLAFKKGITVLNSPGTIDADYRGEIGIILVNLSHEAFVIENGERIAQLIIAKHERA
EWIQVQDLSETSRGEGGFGSTGVK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaaaataatcaacaaatcccaacacgaattacccaactacgaaaccattggt
tcagcaggaatggatttgcgtgccaatattcaagcaccaataacactccaaccactagaa
agaacccttgtaaaaacaggactctttatcgaattgcccataagttacgaagcacaagta
cgaccacgcagcggattggcattcaaaaaaggaatcacagtactcaattcaccaggaaca
atcgatgccgattaccgaggagaaattggcataattttagtaaatttatcccacgaagcc
tttgtaatcgaaaacggcgaacgaatcgcccagctcatcatcgccaaacacgaaagagca
gagtggattcaagttcaagatttatcagaaacttcacgtggcgaaggcggttttggaagt
acaggagtaaaataa

DBGET integrated database retrieval system