KEGG   Flavobacterium psychrophilum JIP02/86: FP2450Help
Entry
FP2450            CDS       T00548                                 

Gene name
dut
Definition
dUTP diphosphatase (EC:3.6.1.23)
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FP2450 (dut)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     FP2450 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2816893..2817327)
Genome map
AA seq 144 aa AA seqDB search
MQIKIINKSQHELPNYETIGSAGMDLRANIQAPITLQPLERTLVKTGLFIELPISYEAQV
RPRSGLAFKKGITVLNSPGTIDADYRGEIGIILVNLSHEAFVIENGERIAQLIIAKHERA
EWIQVQDLSETSRGEGGFGSTGVK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaaaataatcaacaaatcccaacacgaattacccaactacgaaaccattggt
tcagcaggaatggatttgcgtgccaatattcaagcaccaataacactccaaccactagaa
agaacccttgtaaaaacaggactctttatcgaattgcccataagttacgaagcacaagta
cgaccacgcagcggattggcattcaaaaaaggaatcacagtactcaattcaccaggaaca
atcgatgccgattaccgaggagaaattggcataattttagtaaatttatcccacgaagcc
tttgtaatcgaaaacggcgaacgaatcgcccagctcatcatcgccaaacacgaaagagca
gagtggattcaagttcaagatttatcagaaacttcacgtggcgaaggcggttttggaagt
acaggagtaaaataa

DBGET integrated database retrieval system