KEGG   Flavobacterium psychrophilum JIP02/86: FP2543Help
Entry
FP2543            CDS       T00548                                 

Definition
(RefSeq) Transposase IS1 family
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1171304..1171723
Genome map
AA seq 139 aa AA seqDB search
MEILACPKCQNNVIIKSGVINNKQRYLCKKCNYYFTVNKLGKKIDDYYVVKALQLYLEGL
SYREIERIIGVSHVTVSNWVKEYRIKKKSQGNYHPTYKILNHLELVEYIKNKDLLSGAGM
IITELGDKFMLMKWKRFKD
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggagattttagcttgcccaaaatgccaaaacaatgtgattataaaaagcggtgtgatt
aataataaacaaaggtatttatgcaaaaaatgcaattattattttacagtaaataaacta
ggtaaaaagattgatgattattatgttgttaaagctttacagctttatttagaagggctt
agttatcgagaaatagaacgcattattggggtttcgcatgttacggtaagtaactgggta
aaagagtatagaataaaaaaaaaatcgcagggtaattaccatcctacttataaaatattg
aatcatttagagctggtagaatatattaaaaataaggatttattatctggtgcaggaatg
attataaccgagcttggcgataagtttatgcttatgaaatggaaacgttttaaagattaa

DBGET integrated database retrieval system