KEGG   Fusarium pseudograminearum: FPSE_03784Help
Entry
FPSE_03784        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
fpu  Fusarium pseudograminearum
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FPSE_03784
   00500 Starch and sucrose metabolism
    FPSE_03784
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FPSE_03784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 549 aa AA seqDB search
MRSNLLSTVVGLSQFYSVAIAQSSTTITVPTGTPVPGNYNGTYRPQVHFSPPEHFMNDPN
GMFRDADGLWHLYYQYNPTALVAGNQHWGHATSKDLYHWVNQPIALFPPEKDTYVFSGSV
VVDENNTSGFFPDQDNGVVAIYTLSSPEVQDQAIAYSRDGGYTFEPYKGNPVIPSTSTQF
RDPKVIRYKDSWIMVVAYPQDFAIGIFESPDLKEWTATSNFSHHGLLGLQYECPNMISIP
YYDEDGKKQDDMWLMVISINPGAPLGGSIAEYFPGHFNGTHFEAVDAAARIADFGKDNYA
GQWFYGLSEDENPVSIAWASNWQYTQTVPTEDEGWRSAMTLPRENYLTKAKRAGWKLVSK
PYDLEPVMGRELASNDSFGNSNITVDYSDVESNAIYWEVNVTGLPDFGIPSTALMNFTFM
SPVSGESVKAGYYFGGDAVYFLDRGNTRGFDNIFFTDKTSLGSLPASDGSWNTSGVIDRS
IFEGFLNGGVDSVTNTFFATEPLTLMMFSTSDLPEEVKVSISVYALDSAWQKMEGKDGLV
HGNTTSKAD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcaatctcttgtcgaccgttgttggtctttcccaattttattctgtggccatt
gcccagtcttccaccaccatcactgttcccactggcacacccgttcctggcaactacaat
ggcacctatcgtccccaagtccacttctctccacctgaacatttcatgaatgatcccaat
ggcatgttccgtgatgctgatggcctgtggcatttgtactaccagtacaaccctacagct
ctcgtcgctggcaaccagcactggggccatgcaacatcaaaggacttgtaccattgggtg
aaccaacccattgccttgtttcccccggagaaagatacctacgtcttctctggaagtgtg
gttgtcgatgagaacaacacttctggcttcttccctgaccaagacaatggtgtcgtcgca
atctatactctatcatcgccagaagttcaggatcaagctattgcctactcccgagacgga
ggctacactttcgagccttacaagggcaacccagtcatccccagcacttctacccagttc
cgtgatcccaaggtcattcgctacaaggactcttggatcatggtggttgcataccctcaa
gactttgccatcggcatctttgagtcccctgatctgaaagaatggaccgccaccagtaac
ttttcccaccatggtctgctcggcctgcaatatgagtgtcccaacatgatctccatccca
tactacgatgaagatggcaagaaacaggatgacatgtggctcatggtgataagcatcaac
ccaggtgctcccttgggcggttctatcgctgaatacttccccggccacttcaatggtacc
cactttgaggccgttgacgctgctgcgcgaattgcggatttcggaaaggataactacgcc
gggcaatggttctacggactttctgaggatgaaaaccccgtctccatcgcttgggcttcc
aactggcagtacacacaaaccgtccccacagaagatgaaggctggcgaagcgccatgact
cttcctcgcgagaactatttgaccaaggcaaagcgtgctggctggaagttggtatctaag
ccctacgaccttgagccggtcatgggccgtgagctcgcttccaacgatagctttggcaac
tcaaacatcactgtggactactccgatgttgagtccaacgcgatttattgggaagtcaac
gtcactggcctcccagattttggcatcccttcaactgcattgatgaacttcacattcatg
tctccggtctccggcgaaagtgtcaaagctggctactacttcggtggcgacgcagtgtac
ttcctcgatcgtggcaacacccgcggcttcgacaacatcttcttcactgacaagacatct
cttggaagtctgccagccagtgacggctcatggaacacaagcggcgtgattgatcgttct
atctttgaaggtttcctcaatggaggcgtcgacagcgtgacaaacacgttcttcgccaca
gagccattgacgctcatgatgttcagcacatctgatctacctgaggaggtcaaggtcagc
atcagtgtgtatgctttggatagtgcatggcaaaagatggagggcaaggacgggcttgtg
catggaaacacaacttccaaggcagactag

DBGET integrated database retrieval system