KEGG   Fusarium pseudograminearum: FPSE_08448Help
Entry
FPSE_08448        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00052  Galactose metabolism
fpu00500  Starch and sucrose metabolism
fpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FPSE_08448
   00500 Starch and sucrose metabolism
    FPSE_08448
Enzymes [BR:fpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FPSE_08448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 DUF4975
Motif
Other DBs
NCBI-GeneID: 20367066
NCBI-ProteinID: XP_009259841
UniProt: K3VYW2
Position
2
AA seq 582 aa AA seqDB search
MTVKNTTPRPRWHPSPTYHLKAPRGWINDPCAPGYDASTGTYHLSYQWNPKSCDWGDITW
GHLTSRDGLTWKQNTQNPILEPSESYDKEGIFTGCLHPTGLQGEEGQLTVIYSSITHLPI
HWTLPYTRNCAGLSVATSNDGGKTWQKSEQNPILDGEPEGVTVTGFRDPFLAEWPAMDEM
RGEVSMYGFVSGGIVDGGPTVFLYAISPTDLTQWTYLGPLVDLPTGYSPSGKWGGDFGVN
WECVNFMTLHNDSEECPFMLMGTEGGLKPGAKEGAEHWSLWMAGSLEQTKEGPRLKPEFD
GILDHGCLYAPNSYEHPITKNRIVWGWLKEDDLTLSRRENKGWTGYFSLPRELFLYSVDN
VTRSLTSPLQDLGFIKATNNGRGSSTIQTLGIRPLPNLEGLRREKPAYWNSIDSTFGLGG
LTNSHSGCWEVEATIKVSPNDKSAGFWIRHNKDLTQGTAICFSPGSETITIDKSKSNNET
DIEKAPASGPFTLFYSDRNGSEELEKLHLRIFCDGDVLEVFANDRFALSTMVYADSKDCT
GISWFVGSEGSSESVFESVKLWENMREVLEVDEPVVYERSQL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaaaaacacaactcctcgcccaagatggcacccttcacccacatatcatctt
aaagcaccaagaggctggatcaacgacccttgtgcacccggctatgatgcttccactggt
acatatcacttgtcatatcaatggaaccccaaatcctgcgattggggtgacatcacttgg
ggccatctcacaagcagagacggtttaacatggaagcaaaacacacaaaaccccattttg
gaaccctcagaatcatacgacaaggaaggtatctttacaggctgccttcacccaacaggt
cttcaaggcgaggaaggccagctcacagttatctactcctccatcacacatcttcccatt
cactggactctaccatatacccgcaactgcgctggtctctcagtagccacatcaaacgac
gggggaaagacgtggcaaaaaagcgagcagaaccccatattggacggcgaacctgaaggt
gttactgtcacaggtttccgagaccctttcttggcagaatggcccgctatggacgagatg
cgcggtgaggtaagcatgtacggcttcgtatcaggaggtatcgtcgacggtggacctaca
gtgtttttatatgctatctcgccgaccgacttgacgcagtggacctacctcggtccttta
gtcgacctccccaccggatatagcccctctggtaaatggggcggcgactttggtgttaat
tgggaatgcgtcaactttatgacccttcacaacgattccgaagagtgtccgttcatgctc
atgggaacagaaggtggattgaagcccggagcgaaggagggtgctgagcattggtcattg
tggatggctggatctttggagcagacaaaggaaggacccagactcaagccagagtttgac
ggtattctcgaccatggatgtctctatgccccgaattcatatgagcatccaattaccaag
aacagaatcgtctggggatggttgaaggaggacgatttaacgctatcacgccgcgagaac
aagggatggacaggatacttttctcttcctcgagagttattcttgtactctgtcgacaac
gtcacaagatcgcttacatcaccacttcaagaccttggattcatcaaggccaccaataac
ggaagagggtcaagtacgattcagacactgggtatccgaccactaccgaacttggaaggt
ctccgacgggaaaagccagcatactggaattccattgacagcacttttggtctaggaggt
ctcaccaactcacactccggatgttgggaggtggaagccacgataaaggtgtcaccaaac
gataagagcgcaggattctggattcgacacaacaaagaccttacacaaggaacggccatc
tgtttctctcctggaagcgagacaatcacaatcgacaagagcaagtcaaacaacgagacc
gatatagaaaaggccccagcatcaggcccattcactctattctactccgacagaaacggt
tcagaggagctggagaaactacatttgcgcatcttctgtgatggagatgttctcgaggta
ttcgccaacgaccgcttcgctttatcgaccatggtttacgccgattcaaaagattgcacc
ggcattagttggttcgtgggaagcgaagggtccagtgagagtgtctttgagtctgttaag
ctatgggagaatatgagagaggtgctagaggtggatgagcccgttgtttatgaacgaagt
cagctttaa

DBGET integrated database retrieval system