KEGG   Frankia sp. CcI3: Francci3_0045Help
Entry
Francci3_0045     CDS       T00320                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_0045
   00030 Pentose phosphate pathway
    Francci3_0045
   00500 Starch and sucrose metabolism
    Francci3_0045
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_0045
Enzymes [BR:fra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Francci3_0045
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Francci3_0045
  Exosomal proteins of other body fluids (saliva and urine)
   Francci3_0045
  Exosomal proteins of colorectal cancer cells
   Francci3_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
56163..57833
Genome map
AA seq 556 aa AA seqDB search
MSTTEPAAPVAPLDITATEEWAALTTHLREISEVSLRDLFAADPRRGETFAAEADGLYLD
YSKNRLTARTVELLTALARRAGLADRIEAMFRGERINVTENRPVLHVALRAPAGTRIEVD
GVDVVPDVHRVLDAMSQFADRVRSGDWLGATGERIRTVVNIGIGGSDLGPAMAYDALRDY
ADRSIEVRFVSNVDPTDIWEATADLDPASTLFIVSSKTFTTLETISNARAARSWLTGLLG
EDAVSRHFVAVSTNAEKVAEFGIDTVNMFEFWDWVGGRYSVDCAIGLSLMIAIGPPNFRE
FLAGFAAMDTHFRTAPFERNLPVLLGLIGLWYRDFFGTATHAVLPYSHYLGRFPAYLQQL
DMESNGKSVDLTGRPVSTPTGPIVWGTPGTNGQHAYYQLLHQGTTIVPADFIGFVRPNHP
GVGTADGAGVDQHALLLANFLAQTEALAFGRTAAEVAAEGVTPDLVAHRTFPGNRPSNTL
LAQKLTPFALGQLIALYEHKVFTQGVIWGINSFDQWGVELGKVLAGRIIPELGSEQEPEL
GHDSSTNALIKRLRAG
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaaccgagcccgctgccccggtggctccgctggacatcaccgcgaccgaggaa
tgggcggcgctcaccacgcatctgcgcgagatctccgaggtgtccctgcgggatctgttc
gccgccgatccccggcgtggcgagacgttcgccgccgaagcggacggactctatcttgac
tactccaagaaccggctgaccgcgcgcaccgtcgagttgctgaccgcgctggcccggcgc
gccgggctggcggaccggatcgaggcgatgttccggggcgagagaatcaacgtcaccgag
aaccgaccggtgttgcacgtggcgttgcgcgccccggccggaacccggatcgaggtggat
ggcgtcgacgtcgtccccgacgtgcatcgggtgctcgacgcgatgtcccaattcgccgac
cgggtgcggtcgggggactggctgggggccaccggtgagcggatccggacggtggtcaac
atcggcatcggcggctccgacctgggacccgccatggcctacgacgccctgcgcgactat
gccgaccggtcgatcgaagtccggttcgtctccaacgtcgaccccaccgacatctgggag
gctaccgccgatctcgatccggccagcaccctgttcatcgtctcgtccaagacgttcacc
accctggaaacgatctccaacgcgcgggccgcacggtcctggctcaccggcctgctcggc
gaggacgccgtttcccggcacttcgtcgcggtctccacgaatgccgagaaggtcgccgag
ttcggtatcgacaccgtgaacatgttcgagttctgggactgggtgggcggccggtactcg
gtggactgcgcgatcggcctctcgctgatgatcgcgatcgggccgccgaacttccgggag
ttcctcgccggtttcgccgctatggacacgcacttccggacggctccgttcgagcggaac
cttccggttctgctcggtctgatcggcctgtggtaccgcgacttcttcggtacagcgacg
cacgcggtgctgccctacagccactacctgggccgattcccggcttatctccagcagctg
gacatggagagcaatgggaagtcggtcgatctcaccgggcggcccgtgtcgacgccgacc
ggaccgatcgtctgggggactcccggcacgaacggacagcatgcgtactaccagctcctg
caccaggggacaacgatcgttccggccgatttcatcggcttcgtccggccgaaccatccc
ggggtgggcacggcggatggcgccggggtggaccagcacgccctgctgctggccaacttc
ctggcgcagacagaggccctcgcgttcggccggacagccgcggaggtggccgccgagggt
gtcacgccggacctcgttgcgcatcggaccttcccgggtaatcgaccctcgaacaccctg
ctggcccagaagctgactccgttcgccctcggtcagctgatcgcactgtacgagcacaag
gtgttcacccagggggtcatctgggggatcaacagtttcgaccagtggggcgtggagctc
ggcaaggtgctggccggtcggatcattccggaactcgggtccgagcaggaaccggagctg
gggcatgacagctcgacgaatgctctgatcaagcgtctgcgggccggctga

DBGET integrated database retrieval system