KEGG   Frankia sp. CcI3: Francci3_0237Help
Entry
Francci3_0237     CDS       T00320                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fra  Frankia sp. CcI3
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Francci3_0237
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Francci3_0237
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Francci3_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(277305..278336)
Genome map
AA seq 343 aa AA seqDB search
MAVVRRDILLDDDARKAYIRGIKLLKHEPTTLRTNQFGIPGPSRPVRTYDLFVIWHVIAM
NTPVPPGGSPSNRNAAHAGPVFLPWHRVMLGWLEVHLQRVLGDPNFGLPYWDWARDGTPS
APATAPNPAASALWRNTPDGFGGQGTPIPGGAFFFDPADPTSFRVRISTSSSGALQQVVE
RGVRRRFGSATFGSSILPSNADITAAFDTVADPTLASYDEAPFNVSSRGFRNRLEGFIGT
GLHNQVHRWVGGGRDMSLASSPNDPVFFVHHCNVDRVWEGWMRRHGRVYQPDMTAPASLL
GHRIDDPLVSPFAPSSTSSTPSTPATPRSVLDMTDTYTYDVLP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgtccggcgcgacatccttctcgacgacgacgcgagaaaggcctatatccgc
ggaatcaagctcctcaaacacgaacctacgacgctgcgcacgaatcagttcggcatcccc
ggtccgagccgaccggtacggacctacgacctgttcgtcatctggcatgtcatcgcgatg
aacacccccgtccccccgggagggtcaccgagcaaccgcaacgccgcgcacgccggcccc
gtcttcctgccctggcaccgggtcatgcttggctggctggaagtgcacctccagcgcgtt
ctcggcgacccgaacttcgggctgccctactgggactgggcgcgcgacgggacaccctcc
gcccccgccacggcgccgaaccccgctgcttcggcactgtggcggaacaccccggacggt
ttcgggggccagggcaccccgatccccggcggtgcgttcttcttcgaccccgccgacccg
accagcttccgggtacggatctccaccagcagcagcggcgcgctccagcaggtcgtcgaa
cgcggcgtgcggcgtagattcggcagcgccacgttcggatcgtcgatcctgccgagcaac
gccgatatcaccgcagccttcgacaccgtcgccgatccgacactcgcgagctacgacgag
gctcccttcaacgtgagttcgcgggggttccgcaaccgtctcgaaggcttcatcggcacc
ggactgcacaaccaggtccaccgctgggttggcgggggcagggacatgtcgctggcgtcg
tcccccaacgacccggtcttcttcgtgcaccactgcaacgtcgaccgtgtctgggagggt
tggatgcggcgtcacggccgcgtgtaccagccggacatgaccgccccggcaagcctcctc
ggccatcggatcgacgacccgctggtctccccgttcgccccgtcgagcacgtcgagcacg
ccgagcaccccggcgaccccccgcagcgtgctcgacatgaccgacacctacacctacgac
gtcctgccctga

DBGET integrated database retrieval system