KEGG   Frankia sp. CcI3: Francci3_0264Help
Entry
Francci3_0264     CDS       T00320                                 

Definition
molecular chaperone GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Francci3_0264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_0264
  Lipid metabolism
   00071 Fatty acid degradation
    Francci3_0264
  Amino acid metabolism
   00350 Tyrosine metabolism
    Francci3_0264
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Francci3_0264
   00626 Naphthalene degradation
    Francci3_0264
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Francci3_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
305474..306472
Genome map
AA seq 332 aa AA seqDB search
MRAWQVVAPGPMSTRPLRPAELPVPRPGPGQVRVHVDACGVCRTDLHLAEGDLPPHRPRT
VPGHEVVGRVDAVGEGVSGVRTGDRLGIAWLASTDGTCGYCRRGAENLCPASTYTGWDVD
GGYAEYACVRADYAYRLPDGYSDAELAPLLCAGIVGYRALRRAELPPGGRLGIYGFGASA
HLAAQVAIAQGATVHVMTRSARARELALELGAASAGEAYAAPPEPLDAAVLFAPVGDLVP
VALAALDRGGTLSIAGIHLSDIPPLVYSDHLFQERSVRSTTANTRADGEEFLAIAAEHRL
AVTVSPYPLSAADRALADLAADRVTGAAVLLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcctggcaagtagtcgctcccgggccgatgagcacccgcccgctgcgcccggcc
gagctgcccgtgccccggccagggccgggccaggttcgggtccacgtcgacgcctgcgga
gtctgccgtaccgatctgcacctcgccgagggtgatctcccgccgcaccgaccgcgcacc
gtgcccggacatgaggtcgtcggacgggtcgacgcggttggcgagggggtgagcggcgtg
cgcaccggggaccggctgggcatcgcctggctggcctcgaccgacgggacctgcgggtac
tgtcggcgcggagcggagaacctctgcccggcctcgacctacaccggatgggatgtcgac
ggcggatacgccgagtacgcctgcgtgcgcgccgactatgcctaccggctgcccgacggc
tacagcgatgcggagcttgccccgctgctgtgcgccggcatcgtcggctaccgggcgctg
cgccgggcggagctgccgcccggcgggaggctcggcatctacgggttcggcgcgtccgcc
catctcgccgcccaggtggcgatcgcacagggcgccaccgtccacgtgatgacgcgctcg
gcgcgggcccgcgagcttgctctggaactcggcgccgcctcggcgggcgaggcgtatgcc
gcaccgcccgagccgctggacgcggccgtgctcttcgccccggtgggtgacctggtgccg
gtggcgctcgccgcgctcgaccgtggcggcacgctgtccatcgcgggcatccacctcagc
gacatcccgccgctcgtttactccgaccatctgttccaggaacggtccgtacgcagcacg
accgccaacactcgcgccgacggtgaggagttcctggcgatcgccgccgagcaccggctc
gcggtgaccgtgtcgccctacccgctgtccgcggccgaccgggccctcgccgacctcgcc
gccgaccgggtcaccggcgcggccgtgctgctgccctga

DBGET integrated database retrieval system