KEGG   Frankia sp. CcI3: Francci3_0487Help
Entry
Francci3_0487     CDS       T00320                                 

Definition
uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_0487
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Francci3_0487
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Francci3_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
569467..571290
Genome map
AA seq 607 aa AA seqDB search
MATRRTKKPVSPVALVGAGPRDPGLLTVLAVETLAAADLVVADPEVAPAVVENLTAEVLR
IGDLEAPKPVRDAEAATAAVVSRARAGDKVVRLYASDPWLTRIGAADAQALAKAKIPYRV
VPGILTGAAVATYAGVAPGAPVTFASTSGVFSSSGTVPASSPFGGSEPVGPLTGPPFGAS
RLGGRPIAGLGGGLGGGLGTGGFGSPLGLGAAGGFGGFGAPISSPGDLDWGALAQTPGTL
VVTAAPTEVGKVAAALVEHGRPGDTPIAVTVDGTTTDQRTVTSTLDRVEADTAPLLTAAP
TPITQVVLSIGPVVATRGKLSWWETRALFGWTVLVPRTKEQAAILSDLLRSHGASPLEVP
TIAVEPPRTAAPMERAITGLVSGRYQWVAFTSVNAVKAVQEKVEERSLDARAFAGVKVAA
IGEATADALRTFGIRPDLVPSGQQSSEGLLADWPDFDDTLDLLDRVLLPRADIATETLVA
GLKERGWQVDDVTAYRTVRAAPPPASIREALKGGRVDAVVFTSSSTVRNLVGIAGKPHET
TVIAVIGPATAATAQELGLRVDVQAPEASIPALVGALAEFAAEHREELGKIGPLAARLPK
PRRGSRR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggccacccgacgaacgaagaagcccgtctccccggtcgccctggtgggtgccggaccg
cgtgaccccggactgctcaccgtcctcgcggtcgagaccctggccgccgccgacctggtg
gttgccgatcccgaggtggcgccggcggtggtggagaacctcaccgccgaagtgctgcgc
atcggcgacctcgaggcgccgaagccggtccgtgacgcggaggcggcgaccgccgcggtg
gtgagcagggcccgtgccggtgacaaggtggtccggctctacgcctccgatccgtggctg
acccgcatcggcgccgcggacgcccaggcgctcgcgaaggccaagatcccctatcgggtg
gtgcccggcatcctcaccggcgccgcggtcgcgacctacgccggggtcgccccgggcgcg
ccggtcaccttcgccagtacctccggggtcttctcgtcgtcgggcaccgtgccggcgtcc
tcgccgttcggcgggagcgagccggtgggtccgctcaccggtcctccgttcggggcctcg
cggctgggcggacggccgatcgccggtctcgggggcgggctcggcggtggcctgggaacc
ggcgggttcggctcgccgctgggcctcggtgccgcgggcggcttcggcgggttcggtgcg
ccgatctcctcccccggtgacctggactggggtgccctcgcccagaccccgggcaccctc
gtggtcacggcggcaccgacggaggtcggcaaggtcgcggcggcgctcgtcgagcacggg
cggcccggtgacaccccgatcgcggtgaccgtggacggcaccaccaccgaccagcgcacc
gtcacctcgacgctcgaccgggtcgaggcggacacggcaccgctgttgaccgcggccccc
accccgatcacccaggtcgtgctgtccatcggcccggtggtcgcgacccgcggcaagctc
tcctggtgggagacccgggcgctgttcggttggacggtgctggtcccgcggaccaaggaa
caggcggcgatcctgtccgacctgctgcgttcgcacggcgcaagcccgctggaggtgccg
acgatcgccgtcgagcccccgcggaccgccgccccgatggagcgcgcgatcaccggtctg
gtctctgggcgctaccagtgggtggccttcacctcggtcaacgcggtcaaggcggtgcag
gagaaggtcgaggaacgcagcctcgacgcccgcgcgttcgcgggggtcaaggttgcggcg
atcggcgaggcgacggccgacgcgctgcgtaccttcggtatccggcccgatctcgtcccg
tccgggcagcagtccagcgaggggctgctggcggactggccggacttcgacgacaccctc
gacctgctcgaccgggtgctgctgccgcgtgccgacatcgccaccgagaccctggtcgcc
ggcctgaaggaacgcggctggcaggtcgatgacgtgacggcctaccgcaccgtgcgtgcc
gctccgccgcccgcatccatccgggaggcgctgaagggcggccgggtcgacgcggtcgtc
ttcacctcatcctcgaccgtgcgcaacctggtcggcatcgccggcaagccccacgagacg
acggtgatcgccgtgatcggtccggcgacggccgccactgcccaggagctcgggctgcgc
gtcgacgtgcaggctccggaggcgtccatccccgcccttgtcggggcgctggcggagttc
gctgccgaacaccgggaggagctcgggaagatcgggccgctcgctgcgcggttgccgaag
ccacggcgaggctcgcggcggtga

DBGET integrated database retrieval system