KEGG   Frankia sp. CcI3: Francci3_0488Help
Entry
Francci3_0488     CDS       T00320                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_0488
Enzymes [BR:fra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Francci3_0488
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Francci3_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
571287..572309
Genome map
AA seq 340 aa AA seqDB search
MRAQARGNGAGAGYPTARPRRLRRSSALRRLVSNVRLHPSDLVLPMFVKEGVADPVPLAS
MPGVVQHTRSSLRGAAVEAAEAGVGGLILFGVPAEKDARGSAADDPDGIVQLALADLASE
VGGDVVLMTDLCLDEYTDHGHCGLLTDSGEVDNDATLARYGAIAVAQARAGAEVVAPSGM
MDGQVGAIRAALDAEGFVDLPIIAYSAKYASAFYGPFREAAECAPQFGDRTGYQQDPARS
AEEARREVALDLAEGADAVMVKPALAYLDVLRAVADTVDVPVAAYQVSGEYAMVEAAAAA
GWIDRDRAIDETLTAISRAGADIILTYWATEVARRLAAAR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcgcaggcccgggggaacggggccggggccggctatccgacggcacgtccccgc
cggctgcgccgctcgtccgcgctgcgccggctggtctcgaacgtgcggttgcacccgtcc
gacctggtgctgccgatgttcgtcaaggagggcgtggccgatcccgttccactggcctcg
atgcctggtgtcgtccagcacacccgctcctcgctgcggggggcggccgtcgaggccgcc
gaggccggcgtgggcgggctcatcctgtttggtgtgcccgcggagaaggacgcccggggc
tcggccgccgacgacccggacggcatcgtccagctcgcgctcgccgatcttgcctccgag
gtcggtggcgacgtcgtcctgatgacggacctgtgcctggacgagtacaccgaccacggg
cactgcggtctgctcaccgactccggggaggtcgacaacgacgccaccctggcgcgctac
ggcgcgatcgccgtggcgcaggcccgtgcgggtgccgaggtcgtcgcgccgagcgggatg
atggacggccaggtcggcgcgatccgggccgcgctggacgcggagggcttcgtcgacctg
ccgatcatcgcctactcggctaagtatgcttcggcgttctacgggccgtttcgcgaggcc
gccgagtgcgccccgcagttcggggaccggaccggttaccagcaggatccggctcgctcg
gccgaggaggcccggcgcgaggtcgcgctcgacctcgccgagggcgcggacgcggtgatg
gtgaaaccggcgctggcctacctggacgtgctgcgggcggtggccgacacggtggacgta
ccggtggcggcctaccaggtgtcgggcgagtacgcgatggtggaggccgccgcggcggcc
gggtggatcgaccgggaccgggcgatcgacgagacgctgaccgcgatctcccgggccggg
gcggacatcatcctgacctactgggccaccgaggttgcccgccgcttggccgccgcccgc
tga

DBGET integrated database retrieval system