KEGG   Frankia sp. CcI3: Francci3_0680Help
Entry
Francci3_0680     CDS       T00320                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fra  Frankia sp. CcI3
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_0680
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Francci3_0680
   00650 Butanoate metabolism
    Francci3_0680
  Energy metabolism
   00190 Oxidative phosphorylation
    Francci3_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(777194..777655)
Genome map
AA seq 153 aa AA seqDB search
MTTAPPGGPAGPRAPELVAPRTPGLSRRRGKPGSAKARTNFELYAWVFMRVSGLLLFFLV
LGHLFIMNILDGGVQRVNFGFVAGRWASPFWRTWDLVMLLLAELHGTNGLRTIINDYAGR
PQTRFWLKTLLYTSAFLVVALGTLVIFTFDPDI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgctccccccggtggcccggcgggcccgcgcgcgccggaactcgtcgcgccc
cgcacccccgggctctcccgccggcgggggaagccgggcagcgccaaggcgcgcaccaac
ttcgagctctacgcctgggtattcatgcgggtcagcggcctgctgttgttctttctggtg
ctcggccacctgttcatcatgaacatcctcgacggcggggtgcagcgggtgaacttcgga
ttcgtcgccggccgctgggcgtcaccgttctggcgcacctgggacctggtgatgctgctc
ctggcggagctgcacggcaccaacggcctgcgcacgatcatcaacgactacgccgggcgg
ccccagacccggttctggctgaagacgctactctatacctcggcgttcctggtcgtcgcc
ctcggcaccctcgtcatcttcaccttcgatcccgacatctga

DBGET integrated database retrieval system