KEGG   Frankia sp. CcI3: Francci3_0685Help
Entry
Francci3_0685     CDS       T00320                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fra  Frankia sp. CcI3
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fra00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
783059..784363
Genome map
AA seq 434 aa AA seqDB search
MSGSFDVVDLIRAKRDGRPVDPRAVDWLVDAYTRGLVADEQMSAYLMAVVWRGMTPAELD
RWTAAMIDSGERLDLTGVGRPTVDKHSTGGVGDKVSLVLVPLVAACGAAVPQLAGRGLGH
TGGTLDKMEAIPGWRADLSAARMRELLAEVGAVIAAAGAGLAPADRRLYALRDVTGTVES
IPLIASSIMSKKIAEGTSALVLDVKVGSGAFMTSVDEARELARTMVRIGVAAGVRTEALL
TGMDHPLGRTAGHALEVAEAVETLRGGGPADLVEVTVALARVMIDLVAAELGHRSGALHD
PAQVLAAGDAFAVWRAMVAAQGGDPDAPLPAASHVETVPAPATGHLHRLDARAVGLAAWR
LGAGRVRKEDAVSATAGVRWRVGIGDPVTAGEPLLELHTDDPASVERAREALAGAVEVAA
TPPPSTPLVLDHIS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggaagcttcgacgtcgtcgatctgatccgggccaagcgggacggtcgacccgtc
gatccccgggccgtcgactggctcgtcgacgcctacacccggggtctggttgccgacgag
cagatgtcggcgtacctgatggcggtggtgtggcgcgggatgactcccgccgagctggac
cgctggaccgccgcaatgatcgacagtggggagcgcctggatctgaccggtgtgggacgt
cccaccgtcgacaaacactccaccggaggggtcggcgacaaggtctcgctcgtgctggtg
ccgctggtcgccgcctgtggggccgcggtcccacagctcgccgggcgggggctcggtcac
accggtggaacgctggacaagatggaggcgatccccggctggcgggcggatctgtcggcc
gcccggatgcgtgagctcctcgccgaggtgggtgcggtgatcgccgccgcgggtgccggc
ctcgccccggccgaccgccggctctacgcgctgcgggacgtcaccggaaccgtcgagtcg
atcccgctcatcgcatcgtcgatcatgagcaagaagatcgccgagggcacgtcggcgctg
gtcctggacgtcaaggtcggctccggggccttcatgacgtcggtggatgaggcccgtgag
ctcgcccggacgatggttcggatcggcgttgccgccggggtccgcaccgaggccctgctg
accgggatggaccatcccctcggccggaccgccgggcatgcgctggaggtggccgaggcc
gtggagaccctccgtggtggtgggccggcggatctggtggaggtcaccgtcgcgctggcc
agggtgatgatcgacctcgtcgccgccgaactcggccaccggtccggtgctcttcatgat
cccgcgcaggtactggctgccggggacgcttttgcggtgtggcgggcgatggtcgcggcc
cagggcggcgatccggacgcgccgcttccggcggcgagccatgtcgagaccgtccccgcg
ccggcgaccggccatctccaccgcctggacgcccgagcggtcggcctggcggcctggcgg
cttggcgcgggccgggtccgcaaggaggacgcggtctccgcgacggcgggcgtgcggtgg
cgggtgggaatcggtgacccggtcacggccggcgagccgttgctggaactgcacaccgat
gacccggccagcgtcgagcgggcccgggaggccctggcgggagcggtggaggtcgccgcg
acgccgcccccgagcacaccgcttgtcctcgatcacatcagctga

DBGET integrated database retrieval system