KEGG   Frankia sp. CcI3: Francci3_0685Help
Entry
Francci3_0685     CDS       T00320                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
fra  Frankia sp. CcI3
Pathway
fra00240  Pyrimidine metabolism
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Francci3_0685
Enzymes [BR:fra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Francci3_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl Reprolysin_2
Motif
Other DBs
NCBI-ProteinID: ABD10069
JGI: Francci30685
RhizoBase: Francci3_0685
UniProt: Q2JF73
Position
783059..784363
Genome map
AA seq 434 aa AA seqDB search
MSGSFDVVDLIRAKRDGRPVDPRAVDWLVDAYTRGLVADEQMSAYLMAVVWRGMTPAELD
RWTAAMIDSGERLDLTGVGRPTVDKHSTGGVGDKVSLVLVPLVAACGAAVPQLAGRGLGH
TGGTLDKMEAIPGWRADLSAARMRELLAEVGAVIAAAGAGLAPADRRLYALRDVTGTVES
IPLIASSIMSKKIAEGTSALVLDVKVGSGAFMTSVDEARELARTMVRIGVAAGVRTEALL
TGMDHPLGRTAGHALEVAEAVETLRGGGPADLVEVTVALARVMIDLVAAELGHRSGALHD
PAQVLAAGDAFAVWRAMVAAQGGDPDAPLPAASHVETVPAPATGHLHRLDARAVGLAAWR
LGAGRVRKEDAVSATAGVRWRVGIGDPVTAGEPLLELHTDDPASVERAREALAGAVEVAA
TPPPSTPLVLDHIS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggaagcttcgacgtcgtcgatctgatccgggccaagcgggacggtcgacccgtc
gatccccgggccgtcgactggctcgtcgacgcctacacccggggtctggttgccgacgag
cagatgtcggcgtacctgatggcggtggtgtggcgcgggatgactcccgccgagctggac
cgctggaccgccgcaatgatcgacagtggggagcgcctggatctgaccggtgtgggacgt
cccaccgtcgacaaacactccaccggaggggtcggcgacaaggtctcgctcgtgctggtg
ccgctggtcgccgcctgtggggccgcggtcccacagctcgccgggcgggggctcggtcac
accggtggaacgctggacaagatggaggcgatccccggctggcgggcggatctgtcggcc
gcccggatgcgtgagctcctcgccgaggtgggtgcggtgatcgccgccgcgggtgccggc
ctcgccccggccgaccgccggctctacgcgctgcgggacgtcaccggaaccgtcgagtcg
atcccgctcatcgcatcgtcgatcatgagcaagaagatcgccgagggcacgtcggcgctg
gtcctggacgtcaaggtcggctccggggccttcatgacgtcggtggatgaggcccgtgag
ctcgcccggacgatggttcggatcggcgttgccgccggggtccgcaccgaggccctgctg
accgggatggaccatcccctcggccggaccgccgggcatgcgctggaggtggccgaggcc
gtggagaccctccgtggtggtgggccggcggatctggtggaggtcaccgtcgcgctggcc
agggtgatgatcgacctcgtcgccgccgaactcggccaccggtccggtgctcttcatgat
cccgcgcaggtactggctgccggggacgcttttgcggtgtggcgggcgatggtcgcggcc
cagggcggcgatccggacgcgccgcttccggcggcgagccatgtcgagaccgtccccgcg
ccggcgaccggccatctccaccgcctggacgcccgagcggtcggcctggcggcctggcgg
cttggcgcgggccgggtccgcaaggaggacgcggtctccgcgacggcgggcgtgcggtgg
cgggtgggaatcggtgacccggtcacggccggcgagccgttgctggaactgcacaccgat
gacccggccagcgtcgagcgggcccgggaggccctggcgggagcggtggaggtcgccgcg
acgccgcccccgagcacaccgcttgtcctcgatcacatcagctga

DBGET integrated database retrieval system