KEGG   Frankia sp. CcI3: Francci3_0793Help
Entry
Francci3_0793     CDS       T00320                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_0793
Enzymes [BR:fra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Francci3_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(923382..924533)
Genome map
AA seq 383 aa AA seqDB search
MFPASATSREPAVSAALPPLLGFTVGVTAARRRDELANLLERRGARVVHAPALRIVPLAD
DSLLLAATRECLTRPLDAVIATTAIGFRGWVEAAEGWGLGERLRDRLDGARLFTRGPKVT
GAVRAAGLTECWSPRSESGAELVAHLLTENLAGLRIAVQLHGEPLPDMVEGLRAAGAEVV
EIPVYRWEPPDDLRPVRRMVELIVTGGVSAVTFTSAPAVVSLLRIAREMGQFDELLTALR
GEVLPACVGPVCAAPLERQGVATVTPDRFRLGALVRTLSDELPRRRVRTVEAAGHVLRVQ
GGAVIVNGEPVMLAPRTAAVLDALTERPGRVLSRAELLRRTGTAGLTDEHAVEMTVARLR
TALGPAGCAVETVIKRGYRLAVV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgttcccggcgtcggcgacatcgagggagccggccgtcagcgccgcgctgccaccgctg
ctcggcttcaccgtcggggtcacggccgcgcgtcgccgcgacgagctcgcgaacctcctc
gaacggcgcggagcccgggtggtccatgccccggccctgcgcatagtgccgcttgccgac
gacagcctgctgctcgccgcgacccgggagtgcctcacccggccgctggacgcggtgatc
gccacgacggcaatcggcttccgcggctgggtggaggccgccgagggctgggggctcggc
gagcggctgcgcgaccggctggacggcgcccggctgttcacccgcgggccgaaggtcacc
ggcgccgtccgggccgcggggctgaccgagtgctggtcgccccgctcggaatccggcgcc
gagctcgtcgcccatctgctcacggagaacctggccgggctgcgcatcgcggtgcagcta
cacggcgagccattgccagacatggtcgagggactgcgcgcggcgggtgccgaggtcgtc
gagataccggtgtaccggtgggaaccaccggacgatctgcggccggtccgccggatggtc
gagctcatcgtcaccggcggggtctccgcggtcaccttcaccagcgcgcccgccgtggtg
agcctgctacggatcgcccgggagatgggacagttcgacgaactgctgaccgcgctgcgt
ggcgaggtactgcccgcgtgcgtgggtccggtctgtgccgcccccctcgaacggcagggc
gtggcgacggtgaccccggaccggttccggctcggagcactcgtgcgcacgctgtccgac
gagctcccgcgtcgccgggtgcggaccgtcgaggccgcggggcacgtgctgcgggtccag
ggcggggcagtgatcgtcaacggcgagccggtgatgctcgcacccaggaccgcggcagtc
ctcgacgcgctgaccgagcgtcccggccgggtgctgtcccgagccgagctgctgcgccgg
acgggcacggccgggctgaccgacgaacacgcggtcgagatgaccgtcgcccggttacgc
accgcgctgggaccggccggctgcgcggtcgagaccgtcatcaagcggggctatcggctc
gcggtcgtgtga

DBGET integrated database retrieval system