KEGG   Frankia sp. CcI3: Francci3_0848Help
Entry
Francci3_0848     CDS       T00320                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fra  Frankia sp. CcI3
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Francci3_0848
Enzymes [BR:fra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Francci3_0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
989554..990576
Genome map
AA seq 340 aa AA seqDB search
MTARNGDREPGPDAPGYAGLATFCGLPWLPGTEALAARRPDVAVVGAPFDISTTHRPGAR
FGPRAMRANAYNPGTYHLDLGIEIFDWLDVVDAGDAHCPHGLTEASHRNIRAKVARIAGL
GTIPLVIGGDHSITWPAATGVADAVGWGELGLLHFDAHADTADVIDGNLASHGTPMRRLI
ESGAVRGRNFVQVGLRGYWPPPDVFAWMREQEMTWHLMHEIWERGSRDVVVDAIAQATDG
CRAMYLSVDIDVLDPGFAPGTGTPEPGGMTPADLLRAVRQIALDTPLVAADIVEVSPPYD
HAETTVNSAHRVAMEVFAGLAYRRREAAGGVPDLPGSAPA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacgaaacggcgatcgtgagccgggtccggacgcgcccggctacgcggggctc
gcgaccttctgcggactgccctggctgcccgggacggaggcgctggcggcccgccggccc
gacgttgccgtcgtcggtgctccgttcgacatctcgacgacccaccgtcccggcgcccgg
ttcggccctcgggcgatgcgggccaacgcctacaaccccggcacctaccatctcgacctc
ggtatcgagatcttcgactggctcgacgtcgttgacgctggcgacgcgcactgtccgcat
gggctcaccgaggcgtcccatcgcaacatccgggccaaggtcgcgcggatcgccgggctc
ggcacgatcccgctcgtcatcggtggcgaccattcgatcacctggccggccgcaaccggc
gtggccgacgccgtgggctggggtgaactcggtctgctgcacttcgacgcgcatgccgac
accgcggacgtcatcgacggcaacctcgcctcgcacggcactccgatgcgacggctcatc
gagtccggtgccgtgcgtggacgcaactttgtccaggtggggctgcgcggctactggccg
ccgccggacgttttcgcctggatgcgcgagcaggagatgacctggcatctcatgcacgag
atctgggagcggggcagccgtgacgtcgtcgtggacgcgatcgcgcaggccacggacggg
tgccgggccatgtacctgtcggtcgacatcgacgtcctggatccggggttcgcgccgggc
accggcaccccggaacccggggggatgaccccggccgacctgctgcgggcggtccgtcag
atcgcgctcgacacgccgcttgtggccgccgacatcgtcgaagtctccccgccgtacgac
cacgcggaaacgacggtcaacagcgcccatcgcgtcgccatggaggtcttcgcgggactt
gcctaccgcaggcgggaagccgccggtggcgttccggacctgcccgggtcggccccggcc
tga

DBGET integrated database retrieval system