KEGG   Frankia sp. CcI3: Francci3_1157Help
Entry
Francci3_1157     CDS       T00320                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fra  Frankia sp. CcI3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Francci3_1157
Enzymes [BR:fra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Francci3_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1377727..1380000
Genome map
AA seq 757 aa AA seqDB search
MVDPTIDPVLAELAAVSGVATSYLGADGVPVQVAPDTVRAVLRLAGVDPTDPAAALAAAL
ERPWRRRVPACAVVVAAAPRPVVVHTPVEIIPHAELELGTGGRIVLDPPGAPLAERVLDG
VPWVARPIGLPAGLPLGDHVLHIDAGTERHRCQVVAVPAAVPGPAALAPPARAWGWMIQL
YALTSTSSWGMGDYGDLATLADWSGRAGADVLLVNPLHAGAPTLPVAASPYSPASRRFVS
PLYLRPERTPEYARADPATRAAVDKLARGARRDGRRDGLLDRDAVWRAKLAALELLFEVF
RRGGEQVASAGSAASEPAAEPAGSDLIDFATWSALAERYGPDWRTWPARLAHPGAPAVAE
ARAQLADRVAFHVWLQQRCDQQLAAAQAAARAAGMAAGIVHDLAVGVDPGGADAWALQDV
LAVGASVGAPPDTFNQQGQDWGLPPWRPDALAEAGYAPLRQMVASVLRRGGGLRVDHILG
LFRLWWIPAGAGAAHGTYVRYDAEAMLGLLALEAARAGAVVVGEDLGTVEASVATTLARM
NVLGSTVLWFEQDAEGRPLPPTAYRAATMASLTTHDLPTAAGYLEGEHVRTRARLGLLGR
SEEAEAAGWRAERDALVELVRSEGLVDPAGAAAGLGGRGNPGGRGRPEFDPAVRQEIVFA
LHRLLVRSSCRIVLGSPGDALGDRHQPNLPGTTDAYPNWRLPVTDSAGRPVTVERLLTDP
DVRRLGEFLAQVRVAQVRGVSSTGAASPDEDRNPISR
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaccccaccatcgacccggtcctcgccgaactcgccgcagtgtccggcgtggcg
acgtcctacctcggggccgacggtgtcccggtacaggtcgcgccggacaccgtccgggcc
gtcctgcggctggcgggggtcgatccgacggatcccgccgcagcgctcgcggcggcgctg
gagcggccttggcgacgccgggtgccggcctgcgccgtcgtcgtcgccgcagcaccgcgc
ccggtggtcgttcacacgcccgtggagatcattccacacgctgagctggagctcggcacc
ggcggccgaatcgtcctcgatccccctggcgcccccctggccgagcgggtgctcgacggc
gtgccctgggtcgcccggccgatagggctcccggcgggtctgcccttgggggaccacgtg
ctgcacatcgacgccggaaccgagcggcatcgctgccaggtcgttgccgtgccggccgcg
gtgcccggccccgccgccctcgccccgccggcccgcgcctggggctggatgatccagctc
tacgcgctcacctcgacgtcgtcctgggggatgggggactatggcgatctcgcgacgctc
gccgactggtcgggccgggcgggtgccgacgtgctgctggtgaatccgctgcatgcgggt
gcgccgaccctgcccgtcgcggcgtccccctactcgcccgcaagccgccgtttcgtctcc
ccgctctacctgcgaccggagcggacgcccgagtacgcccgggccgatcccgccacccgg
gctgccgttgacaagctcgcccgcggcgcccgtcgcgacgggcggcgggacggtctgctc
gatcgggacgcggtgtggcgggcgaagctggccgcgctggaactgctcttcgaggtcttc
cggcgtggcggcgagcaggtggcatccgccgggtccgccgcttccgagcccgccgccgag
ccggccgggtccgacctgatcgatttcgcgacctggagcgcgctcgccgagcggtacggc
ccggactggcggacctggccggcgcgtctcgctcatccgggcgcgcccgccgtcgccgag
gcgagggcgcagctggccgaccgtgtcgccttccacgtgtggctccagcagcgctgcgac
cagcagctcgccgcggcgcaggccgccgcccgggccgccgggatggccgccgggatcgtg
cacgacctggccgtcggcgtcgatccgggcggtgcggacgcctgggcgctgcaggacgtt
ctcgccgtcggcgcgagcgtgggggccccaccggacaccttcaaccagcagggccaggac
tgggggctgccgccgtggcggccggacgccctggccgaggccgggtacgcgccgttgcgt
cagatggtcgcctcggtgctgcgccgcggcggcgggctgcgggtcgaccacatcctcggc
ctgttccggctgtggtggattccggctggggcgggcgccgctcacgggacatacgtgcgt
tacgacgccgaggcgatgctcggcctgctcgcgttggaggccgcccgtgccggcgccgtc
gtcgtcggggaggatctgggtaccgtcgaggcatcggtggcgacgacgctcgcccgcatg
aacgtgctgggttcgacggtgctgtggttcgagcaggacgccgagggccgcccgttgccg
ccgacggcgtaccgggcggcgacgatggccagcctcaccacgcacgacctgcccaccgcc
gccggctacctcgagggcgagcacgtgcgcacccgcgcccggttggggctgctcgggcgt
tcggaggaggccgaggcggccggctggcgagccgagcgggacgcgttggtcgagctggtg
cgatccgaggggctggtggatccggcgggcgcggcggcgggcctcggcggacgggggaac
cccggcgggcgcggccggccggagttcgaccccgccgttcggcaggagatcgttttcgcg
ctgcaccggctgctggtgcggtcttcgtgccgcatcgtgctcgggtcgccgggtgacgcg
ctgggcgaccggcatcagccgaacctgccgggcacgaccgacgcctatccgaactggcgg
ctcccggtgaccgactccgccggtcggccggttacggtggaacgtctgctgaccgatccg
gacgtgcgccggcttggcgagttcctcgcccaggtccgggttgcccaggtccggggcgtg
tcgtccaccggtgcggcatccccagacgaggaccgtaaccccatttcccggtaa

DBGET integrated database retrieval system