KEGG   Frankia sp. CcI3: Francci3_1228Help
Entry
Francci3_1228     CDS       T00320                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fra  Frankia sp. CcI3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_1228
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Francci3_1228
   00630 Glyoxylate and dicarboxylate metabolism
    Francci3_1228
Enzymes [BR:fra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Francci3_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1470493..1472118
Genome map
AA seq 541 aa AA seqDB search
MGSLDGVTVHGVSAVRTVPGLTAEQVDAVLSDNALAFVAGLHRTFAGRRAELLAARAARR
AAIAAGATLDFLPQTADIRAGNWRVASPAPGLVDRRAEITGPTDAKMLINALNSGARVFM
ADLEDANVPTWSNMVVGQHNLSEAVAGTLAFTSPDGRRYELDESTATLVVRPRGWHLPER
HVTVDGEPIVAALFDAGMYLVRNAHALRATGVAPYFYLPKLESHLEARLWNDVFTAAQAE
LGLPVGTIRATVLIETLPAAFEMEEILYELREHSAGLNAGRWDYMFSTIKTFASRPTEFL
LPDRNGVTMTVPFLRAYTELLVSTCHRRGAHAIGGMAAFIPSRRDPEINAAALAKVRADK
ERESADGFDGSWVAHPDLVPVCTEVFDAVLGDEPNQLTRLRDDVKVGAGDLLAVRDTPGS
VTAAGVRGNISVGVRYLESWLRGIGAVGIDNLMEDAATAEISRSQIFQWIAAGVVLDDGR
PVTADLVRTALAEVLDQIRLSIGAAAFDNGRWKDAAAVFEETALGETFVEFLTLPAYERI
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgttggacggggtgacggtgcacggggtgtccgcggtgcggaccgtgccgggg
ctcaccgcggagcaggtcgacgcggtgctctccgacaacgcgctggccttcgtcgccggg
ttgcaccgcacgttcgccggccggcgtgccgaactgctcgccgcccgggccgcccgccgc
gccgcgatcgcagccggggccaccctggatttcctgccgcagaccgccgacatccgggcc
gggaactggcgggtcgcgtcgccggcgccggggctggtcgaccgtcgggccgagatcacc
ggcccgaccgacgccaagatgctcatcaacgcgctcaacagcggtgcccgggtcttcatg
gcggacctcgaggacgccaacgtgccgacctggtcgaacatggtcgtcggacagcacaac
ctgagtgaggccgtcgccggcacgctcgccttcacctcgcccgacggccgtcgttacgag
ctcgacgagtccacggcgacgctcgtggtgcgcccgcgcggctggcacctgccggagcgg
cacgtcaccgtcgacggggagccgatcgtcgccgcgctcttcgacgccggaatgtacctg
gtccgcaacgcgcacgccctgcgggctacgggcgtggcgccgtacttctacctgccgaag
ctggagagtcatctcgaggcccggctgtggaacgacgtgttcaccgcggcgcaggccgag
ctcggcctgcccgtcggcaccatccgggcgaccgttctcatcgagacgctgcccgccgcc
ttcgagatggaggagatcctctacgagctgcgggagcattccgccggactcaacgctggc
cgctgggactacatgttctccaccatcaagacgttcgcgtcccggccgactgagttcctg
ctgcccgaccgcaacggcgtgacgatgacggtgccgtttctgcgcgcctacaccgagctg
ctggtctccacctgtcatcgccgcggcgcgcacgcgatcggcgggatggcggcgttcatc
ccgtcgcggcgcgaccccgagatcaacgccgcggccctggcgaaggtgcgcgccgacaag
gagcgggagtccgcggacgggttcgacgggagctgggtggcgcaccctgacctggtgccg
gtgtgcaccgaggtcttcgatgcggtgctcggcgacgagccgaaccagctcacccggttg
cgtgacgacgtcaaggtcggcgccggcgacctgctggcggtgcgcgacactccgggttcc
gtcaccgcggccggggtccgcgggaacatcagcgtcggggtgcgctacctggagagctgg
ctgcgcgggatcggggcggtcggcatcgacaacctgatggaggacgccgccaccgctgag
atctcccgtagtcagattttccagtggatagccgccggggtcgtgctcgacgacggccgt
ccggtcacggccgatctggtccggaccgctctggcggaggtgctggaccagatccggctc
tccatcggcgccgccgccttcgacaacggtcgctggaaggacgcggcggcggtgttcgag
gagacggcgctcggcgagaccttcgtcgagttccttactcttcccgcctacgagcggatc
gactga

DBGET integrated database retrieval system