KEGG   Frankia sp. CcI3: Francci3_1228Help
Entry
Francci3_1228     CDS       T00320                                 

Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
fra  Frankia sp. CcI3
Pathway
fra00620  Pyruvate metabolism
fra00630  Glyoxylate and dicarboxylate metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Francci3_1228
   00630 Glyoxylate and dicarboxylate metabolism
    Francci3_1228
Enzymes [BR:fra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Francci3_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase S4 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABD10606
JGI: Francci31228
RhizoBase: Francci3_1228
UniProt: Q2JDN6
Position
1470493..1472118
Genome map
AA seq 541 aa AA seqDB search
MGSLDGVTVHGVSAVRTVPGLTAEQVDAVLSDNALAFVAGLHRTFAGRRAELLAARAARR
AAIAAGATLDFLPQTADIRAGNWRVASPAPGLVDRRAEITGPTDAKMLINALNSGARVFM
ADLEDANVPTWSNMVVGQHNLSEAVAGTLAFTSPDGRRYELDESTATLVVRPRGWHLPER
HVTVDGEPIVAALFDAGMYLVRNAHALRATGVAPYFYLPKLESHLEARLWNDVFTAAQAE
LGLPVGTIRATVLIETLPAAFEMEEILYELREHSAGLNAGRWDYMFSTIKTFASRPTEFL
LPDRNGVTMTVPFLRAYTELLVSTCHRRGAHAIGGMAAFIPSRRDPEINAAALAKVRADK
ERESADGFDGSWVAHPDLVPVCTEVFDAVLGDEPNQLTRLRDDVKVGAGDLLAVRDTPGS
VTAAGVRGNISVGVRYLESWLRGIGAVGIDNLMEDAATAEISRSQIFQWIAAGVVLDDGR
PVTADLVRTALAEVLDQIRLSIGAAAFDNGRWKDAAAVFEETALGETFVEFLTLPAYERI
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgttggacggggtgacggtgcacggggtgtccgcggtgcggaccgtgccgggg
ctcaccgcggagcaggtcgacgcggtgctctccgacaacgcgctggccttcgtcgccggg
ttgcaccgcacgttcgccggccggcgtgccgaactgctcgccgcccgggccgcccgccgc
gccgcgatcgcagccggggccaccctggatttcctgccgcagaccgccgacatccgggcc
gggaactggcgggtcgcgtcgccggcgccggggctggtcgaccgtcgggccgagatcacc
ggcccgaccgacgccaagatgctcatcaacgcgctcaacagcggtgcccgggtcttcatg
gcggacctcgaggacgccaacgtgccgacctggtcgaacatggtcgtcggacagcacaac
ctgagtgaggccgtcgccggcacgctcgccttcacctcgcccgacggccgtcgttacgag
ctcgacgagtccacggcgacgctcgtggtgcgcccgcgcggctggcacctgccggagcgg
cacgtcaccgtcgacggggagccgatcgtcgccgcgctcttcgacgccggaatgtacctg
gtccgcaacgcgcacgccctgcgggctacgggcgtggcgccgtacttctacctgccgaag
ctggagagtcatctcgaggcccggctgtggaacgacgtgttcaccgcggcgcaggccgag
ctcggcctgcccgtcggcaccatccgggcgaccgttctcatcgagacgctgcccgccgcc
ttcgagatggaggagatcctctacgagctgcgggagcattccgccggactcaacgctggc
cgctgggactacatgttctccaccatcaagacgttcgcgtcccggccgactgagttcctg
ctgcccgaccgcaacggcgtgacgatgacggtgccgtttctgcgcgcctacaccgagctg
ctggtctccacctgtcatcgccgcggcgcgcacgcgatcggcgggatggcggcgttcatc
ccgtcgcggcgcgaccccgagatcaacgccgcggccctggcgaaggtgcgcgccgacaag
gagcgggagtccgcggacgggttcgacgggagctgggtggcgcaccctgacctggtgccg
gtgtgcaccgaggtcttcgatgcggtgctcggcgacgagccgaaccagctcacccggttg
cgtgacgacgtcaaggtcggcgccggcgacctgctggcggtgcgcgacactccgggttcc
gtcaccgcggccggggtccgcgggaacatcagcgtcggggtgcgctacctggagagctgg
ctgcgcgggatcggggcggtcggcatcgacaacctgatggaggacgccgccaccgctgag
atctcccgtagtcagattttccagtggatagccgccggggtcgtgctcgacgacggccgt
ccggtcacggccgatctggtccggaccgctctggcggaggtgctggaccagatccggctc
tccatcggcgccgccgccttcgacaacggtcgctggaaggacgcggcggcggtgttcgag
gagacggcgctcggcgagaccttcgtcgagttccttactcttcccgcctacgagcggatc
gactga

DBGET integrated database retrieval system